(data stored in ACNUC7421 zone)

EMBL: CP001111.PE405

CP001111.PE405       Location/Qualifiers
FT   CDS_pept        483465..484838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0405"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   xac:XAC0600 D-alanine/D-serine/glycine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50110"
FT                   /db_xref="GOA:B4SIA5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIA5"
FT                   /protein_id="ACF50110.1"
FT                   /translation="MTEPATPPEHLRRSLSNRHLQLIAIGGAIGTGLFMGSGKTISLAG
FT                   PSIVFVYLIIGAMLFFVMRAMGELLLSNLQYKSFIDFSTDLLGPWAGFFCGWTYWFCWI
FT                   VTAIADVIAIAAYAQFWFPGLDAWIPALACVMLLLALNLVTVKLFGEMEFWFALIKIVA
FT                   ICALIITGAGLVAWGFTSPSGHTAALSNLWNDGGMFPMGLVGFFAGFQIAVFAFVGIEL
FT                   VGTTAAETANPERNLPKAINSIPVRIIIFYVLALIAIMAVTPWRQVVPDKSPFVQLFVL
FT                   AGIPAAASLINFVVLTSATSSANSGIFSTSRMLYGLAEEGHAPRGLSKLSRAAVPARGL
FT                   LFSCLCLLGGTLLIYLIPNLVTAFTLVTTLATVLFIFVWSLILVAYMVYRRRYPERHAA
FT                   SIFKMPGGVAMCWACLVFFAGVLVLLSLQADTRQALIASPAWFVLLGVGYWVRRRTAK"
     atgaccgagc ccgcaacgcc ccccgagcac ctgcgccgca gcctgtccaa ccgccacctg        60
     cagctgatcg ccatcggcgg tgccatcggc accggcctgt tcatgggctc gggcaagacc       120
     atcagcctgg ccggtccgtc catcgtcttc gtctacctga tcatcggtgc gatgttgttc       180
     ttcgtgatgc gcgcgatggg cgagctgctg ctgtccaacc tgcagtacaa atccttcatc       240
     gacttttcca ccgacctgct tggtccctgg gccggcttct tctgtggatg gacgtactgg       300
     ttctgctgga tcgtcaccgc catcgccgat gtgatcgcca tcgccgccta tgcgcagttc       360
     tggttcccgg ggctggatgc ctggataccg gcactggcct gcgtgatgct gttgctggcg       420
     ctgaacctgg tgacggtgaa gctgttcggt gagatggaat tctggttcgc gctgatcaag       480
     atcgtggcga tctgtgcgct gatcatcacc ggtgcgggcc tggtggcgtg gggcttcact       540
     tcgcccagcg gccataccgc cgcgctgtcc aacctgtgga atgacggcgg catgttcccg       600
     atgggcctgg tcggcttctt cgccggtttc cagatcgcgg tgttcgcctt cgtcggcatc       660
     gagctggtcg gcaccaccgc cgccgagacc gccaaccccg agcgcaacct gcccaaggcg       720
     atcaactcga tcccggtgcg catcatcatc ttctacgtgc tggcgctgat cgcgatcatg       780
     gccgtcaccc cgtggcgcca ggtggtgccg gacaagagcc cgttcgtgca actgttcgtg       840
     ctggccggta tccccgccgc ggccagcctg atcaacttcg tggtgctgac ctcggccacc       900
     tcctcggcca acagcggcat cttctccacc agccgcatgc tgtacggcct ggccgaagag       960
     ggccacgcgc cgcgcgggtt gtcgaagctc tcgcgcgccg cagtgccggc acgcggcctg      1020
     ctgttctcct gcctgtgcct gctcggcggc acgctgctga tctacctgat ccccaacctg      1080
     gtgaccgcct tcaccctggt caccacgctg gcgacggtgc tcttcatctt cgtctggtcg      1140
     ctgatcctgg tggcctacat ggtctaccgc cgccgctacc cggagcgcca cgccgcctcg      1200
     atcttcaaga tgcccggtgg cgttgccatg tgctgggcgt gcctggtgtt cttcgcaggc      1260
     gtgctggttc tcctgagcct gcaggccgat acccgccaag ccctgatcgc cagcccggcg      1320
     tggttcgtgc tgctgggcgt ggggtactgg gtgcgacgca ggaccgcgaa gtga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page