(data stored in ACNUC7421 zone)

EMBL: CP001111.PE407

CP001111.PE407       Location/Qualifiers
FT   CDS_pept        complement(486028..487548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cak:Caul_4326 tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50112"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIA7"
FT                   /protein_id="ACF50112.1"
FT                   /translation="MPRVLPLTALLLAALAGSPASASIAVAPQKPSVTSDAVHTAYATR
FT                   WDEAIQQSRSGNTLGALIAMEQLMEDPLLDDFDAEHRGRAAQVAGWTALMQKKPAQARR
FT                   YLQRAQESLPDDAQILLTLVSLELSENQPAPATRYLVQALKHAEGPLPIERQPINYLQY
FT                   RLRDQPQRRMELLQALFDNGWKGGGVEPTGLWLALATLQADNGRGDDIPTTLARINGPA
FT                   EIIRLRSDKRFDRYVDRGDARFDPVQAAQKHLDELRVSGLLDRALDARMAEFSNTLLML
FT                   DRNEEVLALTDGMARAAAEGESPSAAEAEWVAWLLNSRLTALRRLGRTDDALATAKLAA
FT                   RIGALGPDGAEHQFNVGFVLSSLGRLQDATAAVNDMQGLGGYGKAAQALLQFAAARERG
FT                   DAKAMDAARAAILAEGDDARLFHREMLLDEGNLDGAAAVLIEQLRSPVERGETLASLQD
FT                   MRTYPSLPGDVKIDAAWRALKQRADVQAEVTRVGRIERYELVGSATSR"
     atgccccgcg ttctccccct cactgccctg ctgctggccg cactggcggg cagccccgcc        60
     tccgcctcca tcgcggtggc accacagaag ccgtccgtca ccagcgacgc ggtgcatacg       120
     gcctatgcca cccgttggga cgaagcgatc cagcagtcac gcagcggtaa cacgctgggc       180
     gcgttgatcg ccatggaaca gctgatggaa gatccgctgc tggacgattt cgatgccgag       240
     catcgcggtc gcgccgcgca ggtggcgggc tggaccgcat tgatgcagaa gaagccggcg       300
     caggcccggc gctatctgca gcgggcgcag gagtcgttgc cggacgatgc acagatcctg       360
     ctgaccctgg tgtcgctgga actttccgaa aaccagccgg ctccggctac ccggtacctg       420
     gtgcaggcgc tgaagcacgc cgagggcccg ctgccgatcg agcgccagcc gatcaactac       480
     ctgcagtacc gcctgcgcga ccagccacaa cgacgcatgg aactgctgca ggcgctgttc       540
     gacaacggct ggaagggcgg tggcgtggag ccgaccgggc tgtggctggc gttggccacg       600
     ctgcaggccg acaacggccg cggcgacgac atcccgacca cgctggcacg catcaatggc       660
     ccggccgaaa tcatccgcct gcgcagtgac aagcgctttg atcgctatgt cgaccgcggc       720
     gatgcacgct tcgatccggt gcaggccgca cagaagcatc tcgatgagct gcgtgtgtct       780
     ggcctgctcg accgcgccct ggacgcgcgc atggccgagt tcagcaatac gctgctgatg       840
     ctcgaccgca acgaggaagt cctggccctg accgatggca tggcccgcgc agcggccgaa       900
     ggcgaatccc cgtcggcggc cgaagccgaa tgggtcgcgt ggctgctcaa cagccggctc       960
     accgcgctgc gtcggttggg gcgcaccgac gatgcgctgg ccaccgccaa gctggctgcg      1020
     cgcatcggtg cgctgggccc ggatggcgcc gagcaccagt tcaacgtcgg cttcgtgctc      1080
     agttcgctgg gccgcctgca ggacgccacc gcagcggtga atgacatgca gggcctcggc      1140
     ggctacggca aggcagcaca ggcgttgctg cagtttgccg ccgcgcgcga acgtggcgat      1200
     gccaaggcca tggacgctgc tcgcgcggcg atcctcgccg agggcgacga cgcccgcctg      1260
     ttccatcgcg aaatgctgct ggacgagggc aatctcgatg gcgcggccgc cgtgctgatc      1320
     gagcaactgc gctcccccgt cgagcgaggc gagacactgg cctccctgca ggacatgcgt      1380
     acctatccgt cgctgcccgg tgacgtgaag atcgatgcgg cctggcgtgc gctgaagcag      1440
     cgcgccgacg tgcaggcaga agtcacccgc gttggccgca tcgaacgcta cgaactggtc      1500
     ggcagcgcga cctcacgctg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page