(data stored in ACNUC7421 zone)

EMBL: CP001111.PE408

CP001111.PE408       Location/Qualifiers
FT   CDS_pept        487716..489797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0408"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: NHL repeat containing protein;
FT                   SMP-30/Gluconolaconase/LRE domain protein; KEGG:
FT                   ote:Oter_2854 SMP-30/gluconolaconase/LRE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50113"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIA8"
FT                   /protein_id="ACF50113.1"
FT                   /translation="MARWQWMAAGVALATAVALAATWWDSPLQTLAEPAGPAPTPLAWT
FT                   AQIEMLAGDGHPGDRDGASAQARFADPYALLRSADGSIYFTDAGDNNRIRRRQPDGRIE
FT                   TVAGQGEGRIDGPALQASFNTPSGIAADAQGNLYVADTGNHAIRRIGTDGQVTTLAGGE
FT                   QGYADGPAAQARFDAPMGIAVDAQGQVYVADTFNDRIRVIGTDGNVRTLAGGERPGLAD
FT                   GLGVAARFDTPVALAFDAHGALLVADLFNNAVRRVGADGMVSTLLGDGGVINGPLSLAT
FT                   THDGVLYVGDLDGRIVQVTPQGHQIALVGNGRLPRLARPSGLAMDADGSVLVADSASYR
FT                   LHRLRPLPVGDLPAPALVGPAADAALPDTGGRWPLAPQDGWHEVVGTLGEVRGNFKGES
FT                   RHHLHGGFDVRGDVGQTVLAIADGKISSPVAAWSLGGQAEGLAVDRLKYIHMRVGRTPR
FT                   DQPFDARWQALYDEQGKLERMRVRRGTRIHVGDRLGSINNQAHVHLAVGTGGFETNAVA
FT                   LGFHNYADHFAPRITDVALLDDNDQPLAAGSDGVVMLARQGRGVQIVVEAWDQVDNNLP
FT                   RRRLGMYQVGYQILDAGGQPLQGYEQPRWNIVFNRMPPQMEAVRVAYAPDSGITVHGSA
FT                   VTRFRYLATNTVRDGLMETGRWQPAALPPGEYIVRASVRDYSGNEGVGPREIRVRLLP"
     atggcacggt ggcaatggat ggcggcaggg gtcgcgttgg caacggcggt ggcattggcc        60
     gcgacctggt gggattcacc gctgcagacc ttggctgaac cggcaggccc ggcgcccacg       120
     ccactggcct ggaccgcgca gatcgagatg ctggccggcg acggtcatcc cggtgaccgc       180
     gatggtgcgt ccgcgcaggc ccgcttcgcc gatccctatg cgttgctgcg cagtgccgat       240
     ggcagcatct acttcaccga tgccggcgac aacaaccgca tccgccgccg ccagccggat       300
     ggccgcatcg agaccgtggc cgggcagggc gaggggcgca tcgatggccc ggcgctgcag       360
     gccagcttca atacgccgtc gggcatcgcc gccgatgcgc agggcaacct gtacgtggcc       420
     gacaccggca accatgccat ccgccgcatc ggcaccgatg gccaggtgac cacgctggcc       480
     ggtggcgagc aggggtacgc cgatggaccg gccgcgcaag cgcgcttcga tgcaccgatg       540
     ggcatcgcgg tggacgcgca gggccaggtc tatgtggccg acaccttcaa cgaccgcatc       600
     cgggtgatcg gcaccgacgg caacgtgcgt accctggccg gcggcgagcg cccggggctg       660
     gccgatggcc tgggcgtcgc ggcgcgcttc gatacgccgg tggcgctggc cttcgatgcc       720
     catggcgcgc tgctggtggc cgacctgttc aacaatgcgg tgcgtcgggt cggtgccgac       780
     ggcatggtca gcacgctgct gggcgatggc ggcgtgatca atgggccgtt gtcgctggcc       840
     accacgcacg acggcgtgct gtacgtgggt gaccttgatg gccgcatcgt gcaggtaaca       900
     ccgcagggcc accagatcgc gctggtgggc aacggccgcc tgccacgcct ggcccgcccc       960
     agtggtctgg cgatggatgc cgatggcagc gtgctggtcg ccgattccgc cagctatcgc      1020
     ctgcaccgcc tgcgcccgct gccggtgggt gatttgccgg caccggcgct ggtcgggccc      1080
     gctgccgatg cagcgttgcc ggacaccggt gggcgctggc cgttggcacc ccaggacggc      1140
     tggcatgaag tggtgggcac gctgggcgag gtgcgcggca acttcaaggg cgagagccgc      1200
     caccacctgc acggtggttt cgatgtgcgc ggcgatgtcg gccagaccgt gttggcgatc      1260
     gccgatggca agatcagcag cccggtagcg gcgtggagcc tgggtgggca ggccgagggc      1320
     ctggcagtgg accgcctcaa gtacatccac atgcgggtcg gccgcacccc gcgtgaccag      1380
     ccgttcgatg cgcgctggca ggcgctgtac gacgagcagg gcaagctgga gcggatgcgc      1440
     gtgcgtcgcg gcacgcgcat ccacgttggc gatcgcctgg gcagcatcaa caaccaggcg      1500
     cacgtgcacc tggcggtggg caccggcggc ttcgaaacca acgccgtggc gctgggtttc      1560
     cataactacg ccgaccactt cgcaccgcgc atcaccgatg tggcgctgct ggacgacaac      1620
     gaccagccgc tggcggcggg cagcgacggc gtggtgatgc tggcgcggca gggacgtggc      1680
     gtgcagatcg tggtcgaggc ctgggaccag gtcgacaaca acctgccgcg gcgccggctg      1740
     ggcatgtacc aggtgggcta ccagatcctc gatgctgggg gacagccgct gcagggttac      1800
     gagcagccgc gctggaacat cgtgttcaac cgcatgccgc cgcagatgga agcggtgcgc      1860
     gtggcctacg caccggacag cggtatcacg gtgcatggca gtgcggtgac ccggttccgt      1920
     tacctggcca ccaacaccgt gcgtgatggc ctgatggaaa ccgggcgctg gcagccggcg      1980
     gcgctgccgc cgggcgagta catcgtgcgc gccagcgtgc gcgactacag cggtaacgaa      2040
     ggcgtgggcc cgcgcgagat cagggtacgg ctgctgccat ag                         2082
//

If you have problems or comments...

PBIL Back to PBIL home page