(data stored in ACNUC7421 zone)

EMBL: CP001111.PE411

CP001111.PE411       Location/Qualifiers
FT   CDS_pept        491397..491819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0411"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; 3-demethylubiquinone-9
FT                   3-methyltransferase; KEGG: rpe:RPE_4736
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50116"
FT                   /db_xref="GOA:B4SIB1"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB1"
FT                   /protein_id="ACF50116.1"
FT                   /translation="MKLIPFLGFSGQAHEAMAFYAKALGGQVTSEMKYRDMPPSDGSPG
FT                   CNEMPPETLDHVAHSQLEIGSAIVMAADGPGGGEGGSTTINVDVDSIEEAERVFAALAD
FT                   GGQVQMPIAETFWAHRWGMLIDRYGKPWMVNCMKQP"
     atgaaattga ttcccttcct cggcttcagc ggccaggccc atgaggcgat ggcgttctat        60
     gcaaaggcac tcggtggcca ggtcacctcg gaaatgaaat accgcgacat gccgccctcc       120
     gatggctcgc cgggctgcaa cgagatgccg ccggaaaccc tggaccacgt cgcgcacagc       180
     cagctggaaa tcggtagcgc catcgtgatg gcggccgacg gtcccggcgg tggcgagggt       240
     ggctcgacca ccatcaatgt cgacgtcgac agcatcgaag aagccgaacg cgtgttcgcc       300
     gcgctggccg acggtggcca ggtgcagatg ccgatcgccg aaacgttctg ggcgcaccgc       360
     tggggcatgt tgatcgaccg ctacggcaag ccgtggatgg tcaactgcat gaagcagccc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page