(data stored in ACNUC7421 zone)

EMBL: CP001111.PE417

CP001111.PE417       Location/Qualifiers
FT   CDS_pept        496482..497159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_1236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50122"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB7"
FT                   /protein_id="ACF50122.1"
FT                   /translation="MIRNTALVVAIAAATLSMPAHAQFGKLKDLAGAATGTSSSSASSA
FT                   AAPDEAAQEALVRRFVSSQSHSLQAQTSFARAFGLAEQVQLLEAERQALSSGSVSVDAM
FT                   KKSVSVSEAAQAAINERQAAQPELNAESKQHYAEGLVSLLSSAAEAQKLGGEASSFTAG
FT                   MKNLGATQLATVGRKLAAGAWVAKESPGFIKGLYGSTKSAVTFAKKSKVKVPSNADSML
FT                   DSL"
     atgatccgca atactgctct tgtcgtggcc atcgcggccg ccaccctgtc gatgccggcc        60
     cacgcccagt tcggcaagct gaaggacctg gctggcgccg ctaccggcac ctccagcagc       120
     agcgcctcca gcgccgccgc tccggacgaa gccgcgcagg aagcgctggt gcgtcgtttc       180
     gtcagctcgc agtcgcactc tctgcaggcc cagacctcgt tcgcccgcgc cttcggcctg       240
     gccgagcagg tgcagctgct ggaagccgag cgccaggcgc tgtcgtccgg ttcggtcagc       300
     gtcgatgcca tgaagaagtc ggtgtcggtc agcgaagccg cccaggcggc catcaacgag       360
     cgccaggccg cacagccgga actgaacgct gaatccaagc agcactacgc cgaaggcctg       420
     gtctcgctgc tgtcctcggc tgccgaagcg cagaagctgg gcggcgaagc cagcagcttc       480
     accgccggca tgaagaacct gggcgcgacc cagctggcca ccgtcggccg caagctggct       540
     gccggtgcgt gggtggccaa ggaatcgccg ggcttcatca agggcctgta cggttcgacc       600
     aagtcggccg tgacctttgc caagaagagc aaggtgaagg tgccgtccaa cgccgattcg       660
     atgctcgact cgctctga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page