(data stored in ACNUC7421 zone)

EMBL: CP001111.PE420

CP001111.PE420       Location/Qualifiers
FT   CDS_pept        501075..502334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0420"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase internal region; KEGG: xcv:XCV3840
FT                   putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50125"
FT                   /db_xref="GOA:B4SIC0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC0"
FT                   /protein_id="ACF50125.1"
FT                   /translation="MIASLSLILRHLLAWAAALFVAGMVWSGIFSGMNDGPGWVFGLLV
FT                   MFLMISALGSAVTHVRRVWLVAGRLDGATLSGRQRRQIELPMDAGHAFAVVEAAVGELP
FT                   RVEEVESSAGSLQVRAYVRRVDLWNGRQPSRWNLPARLAIKRNSVLATVTPGQGTSTVT
FT                   LLFEPDAGWWADLLALDEGSNYENAEAVTRAISRRVADQRRDEQAAAEQTQVEKELSVA
FT                   RLNLLHAQVEPHFLYNSLANAQVLTRTDPARAEQMLGHLIQYLRSSLPQVDESVSTLGV
FT                   ELERTRAYLEILRIRMGARLAVEVQVPTELHEVKLPAMALQTLVENAIKHGLEPKPGGG
FT                   TIWILARGFDDHVTVTVADDGLGFGQGTSGTGIGLKNLRERLRLTCGEQAGVAIVANFP
FT                   SGVAATMTLPQSAKERSHAA"
     gtgatcgcca gcctctccct catcctccgt cacctgctgg cctgggccgc ggcactgttc        60
     gtggccggca tggtctggag cggcattttc agcggcatga acgacggccc cggctgggtg       120
     ttcgggctgc tggtgatgtt cctgatgatc tcggcgctgg gcagtgcggt aacccatgtg       180
     cgccgggtct ggctggtggc cggccgcctc gatggcgcca ccctgtccgg gcgccagcgt       240
     cggcagatcg aactgccgat ggatgccggc cacgccttcg cggtggtcga ggcggcggtg       300
     ggcgagctgc cgcgggtgga ggaggtggaa agctcggcgg gcagcctgca ggtgcgcgcc       360
     tatgtacgcc gtgtcgatct ctggaacggc cgccagccgt cgcgctggaa cctgccggca       420
     cggctggcga tcaagcgcaa cagcgtgctg gccacggtca cgccggggca gggcaccagc       480
     accgtcaccc tgctgttcga accggacgca ggatggtggg ccgacctgtt ggcgctggac       540
     gagggcagca actacgagaa tgccgaagcg gtcacccgcg cgatcagccg ccgtgttgcc       600
     gaccagcgtc gcgacgagca ggccgccgcc gaacagaccc aggtcgagaa ggagctgtcg       660
     gtggcgcggc tgaacctgct gcatgcgcag gtcgaaccgc atttcctgta caactcgctg       720
     gccaacgcac aggtgctgac ccgcaccgat cctgcgcgcg cagaacagat gctcggccat       780
     ctgatccagt acctgcgcag ttcgctgccg caggtggacg aatcggtatc caccctgggt       840
     gtagagctgg agcgcacccg cgcctacctg gagatcctgc gtatccgcat gggcgcgcgg       900
     ctggcggtgg aagtgcaggt gccgaccgaa ctgcatgagg tgaagctgcc ggcgatggcg       960
     ctgcagacgc tggtggaaaa cgcgatcaag cacggcctgg aacccaagcc cggcggcggc      1020
     acgatctgga tcctggcgcg tggtttcgat gaccatgtga cggtgacggt ggccgacgac      1080
     ggcctcggct tcggccaggg caccagtggc accggcatcg gcctgaagaa cctgcgcgag      1140
     cgcctgcgcc tgacctgcgg cgagcaggcc ggtgtggcga tcgttgccaa cttccccagc      1200
     ggcgtggccg cgaccatgac cctgccgcag tcggccaagg aacgcagcca tgccgcttga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page