(data stored in ACNUC7421 zone)

EMBL: CP001111.PE421

CP001111.PE421       Location/Qualifiers
FT   CDS_pept        502324..503094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0421"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: xcb:XC_3747 transcriptional regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50126"
FT                   /db_xref="GOA:B4SIC1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC1"
FT                   /protein_id="ACF50126.1"
FT                   /translation="MPLEALIAEDEELLRQSLVEQLGRLWPELKLVAECEDGASALEQL
FT                   AEKQPDIAFLDIRMPGISGIEVARSLSELSPRTQVVFVTAYDQYAIDAFEQGAMDYLLK
FT                   PVSDERLLATRERILSRLPSTRQDDAVLERLLQRLGPSQGSADHPPLAWITASNGRETQ
FT                   LIMLEDVAYFRADNKYTTVVTAAGESLLRTPLRELLEVLDPQHFRQIHRSTIVNMKAVA
FT                   AVSRDDTGRGVLRLRQRAETLVVSQPFMSLFRGM"
     atgccgcttg aagcgctgat cgccgaagac gaagaactgc tgcggcagtc actggtggag        60
     cagctgggcc ggctgtggcc ggaactgaaa ctggtggccg agtgcgagga cggcgccagt       120
     gcgctggagc agctggccga gaagcagccg gatatcgcct tcctcgacat ccgcatgcct       180
     ggcatcagcg gcatcgaggt ggcacgttcg ctgtccgaac tgagcccgcg tacccaggtg       240
     gtgttcgtca ccgcctatga ccagtacgcc atcgatgcgt tcgagcaggg cgcaatggat       300
     tatctgctga agccggtgag cgacgagcgc ctgctggcca cgcgcgagcg catcctgtcg       360
     cggctgccat cgacgcgcca ggacgacgcg gtgcttgaac gcctgctgca acggctgggt       420
     ccatcgcagg gcagcgccga ccacccgccg ctggcctgga tcaccgccag caacggtcgt       480
     gagacgcagc tgatcatgct ggaggacgtg gcctacttcc gcgccgacaa caagtacacc       540
     acggtggtca ccgccgccgg cgaaagcctg ctgcgcacgc cgctgcgcga gctgctggaa       600
     gtgctcgacc cgcagcactt ccgccagatc catcgttcga ccatcgtcaa catgaaggcg       660
     gtggcggcgg tgagccgcga cgatacaggg cgcggtgtac tgcgcctgcg ccagcgtgcg       720
     gaaacactgg tggtcagcca gcccttcatg agtctgttcc gcggcatgta g                771
//

If you have problems or comments...

PBIL Back to PBIL home page