(data stored in ACNUC7421 zone)

EMBL: CP001111.PE424

CP001111.PE424       Location/Qualifiers
FT   CDS_pept        504436..505365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV3835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50129"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC4"
FT                   /protein_id="ACF50129.1"
FT                   /translation="MPALLQRLSRPVTAPIRRWVLEAFPRGQSGIDYDHPLGDPGWFGP
FT                   DSVTWRLHAEFPSMLAGGLCALMLQTLHPRALAGVYDHSNFRQDLVGRLRRTTAFVAGT
FT                   SYAPAGEVEMLVAKVRRIHAQIRGQTAQGEHYAADDPQLLTWVHVTEAFGFLQGFRRYG
FT                   REVPAHIADRYYDEYRCVAEALGAVDVPRSEAEVAAYFCARQPELRVDERSREVLEVLS
FT                   GVRLPVPVPGLSREVFLGAGAALLPDWAEGMLERNGRQRAQAAASAKLMRGMAPLFRRA
FT                   LPDGLASRACTRVGVPVDVLREWPTVPR"
     atgccggctc tgctgcagcg actctcccgc cccgtgacgg cgccgatccg gcgctgggtc        60
     ctggaggcct tcccgcgtgg ccagagcggc atcgattacg accacccgct gggtgacccg       120
     ggctggttcg gccccgacag cgtcacttgg cggctgcacg ccgaattccc gtcgatgctg       180
     gccggcggcc tgtgcgcact gatgctgcag accctgcacc cgcgggcgtt ggccggggtc       240
     tacgaccact ccaatttccg ccaggacctg gtgggccgcc tgcgccgcac cacggccttt       300
     gtggccggca ccagctatgc gcccgccggc gaggtcgaga tgctggtggc caaggtgcgc       360
     cgcatccatg cgcagatccg tggccagacc gcgcagggtg agcactatgc ggcggacgat       420
     ccgcagctgc tgacctgggt gcacgtgacc gaggcgtttg gcttcctgca aggcttccgc       480
     cgatacgggc gcgaggtgcc ggcgcacatc gccgatcgtt actacgacga gtaccgctgc       540
     gtggccgagg cattgggtgc ggtggatgtg ccgcgcagcg aagcggaagt ggcggcgtac       600
     ttctgcgcgc ggcagccgga gctgcgcgtg gacgagcgct cgcgcgaggt gctggaggtg       660
     ttgtccggtg tgcgcctgcc ggtaccggtg ccaggcctgt cgcgcgaagt attcctgggg       720
     gccggtgccg cgctgctgcc ggactgggcc gaaggcatgc tcgaacgcaa tggtcgccag       780
     cgggcgcagg cggccgcgtc ggcgaaattg atgcggggca tggcgccgct gttccgccgc       840
     gcgctgcccg atggcctggc cagccgcgcc tgcacgcgcg tgggcgtgcc ggtggatgta       900
     ctgcgcgagt ggcccaccgt tcccaggtag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page