(data stored in ACNUC7421 zone)

EMBL: CP001111.PE425

CP001111.PE425       Location/Qualifiers
FT   CDS_pept        complement(505477..506064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0425"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: eca:ECA1819
FT                   TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50130"
FT                   /db_xref="GOA:B4SIC5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC5"
FT                   /protein_id="ACF50130.1"
FT                   /translation="MVRRTRAEMEETRATLLATARRVFSEHGYAATSMDDLTAQAGLTR
FT                   GALYHHFGDKKGLLAAVVAQLDAETDLRLQAISDTADDAWEGFVQRCRAYLEMALEPEI
FT                   QRIVLRDARAVLGGASPESQRHCVNSMQRLIEQLITQGAVAPVDAQALASLIYGSLAEA
FT                   AFWIADGEQGDARLRQATAALEMLLRGLKSTE"
     atggttcgtc gcacccgcgc cgagatggaa gaaacccgcg ccaccctgct ggccaccgcc        60
     cgccgggtgt tcagcgagca tggctatgcc gccacctcga tggacgacct gaccgcccag       120
     gccgggctga cccgcggcgc gctgtaccac cacttcggcg acaagaaggg tctgctggcg       180
     gctgtcgtcg cccagctcga tgccgagacc gacctgcgcc tgcaggcgat cagtgatacc       240
     gccgacgatg catgggaggg cttcgtgcaa cgttgccgcg cctatcttga gatggcgctt       300
     gagccggaga tccagcgcat cgtgctgcgc gatgcgcgcg cggtgctggg tggcgcctca       360
     ccggaatcgc agcggcactg cgtgaactcg atgcagcgcc tgatcgagca gctgatcacc       420
     cagggtgcgg tggcgccggt ggatgcgcag gcgctggcgt cgctgatcta cggcagcctg       480
     gccgaggccg cgttctggat cgccgacggc gagcagggcg acgcgcgcct gcggcaggcg       540
     acggcggcgc tggagatgct gttgcgtggg ttgaagtcga cggagtaa                    588
//

If you have problems or comments...

PBIL Back to PBIL home page