(data stored in ACNUC7421 zone)

EMBL: CP001111.PE429

CP001111.PE429       Location/Qualifiers
FT   CDS_pept        511001..514063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0429"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: mms:mma_2307 sensory box/GGDEF family protein;
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; EAL domain protein; PAS
FT                   fold-3 domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50134"
FT                   /db_xref="GOA:B4SIC9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC9"
FT                   /protein_id="ACF50134.1"
FT                   /translation="MRGGARRQEWRPPAVEVGDVEDSFAHEASRLHKEDRPMPALKRAL
FT                   ARPLRAITWGGVLLGVLLVAGLTTMLANDHHRRLEAAQRQSRALAVGSERLLALELRNL
FT                   ERAMSGIAADAAELFRRVPVQAPALLDAAIGGVLSRHAELHSIVVLDRHGRAITAGKGD
FT                   LNLPLWTDPQRRGQGSALYIGPPQQAGDDGWVVPLALSMADDRWLLARLRCGELQRIIG
FT                   GLDVGPNGLVSISDAEGYMLARVPDPHGTVGRRFDLPRRDLLGKQAVVELGSVPGAVDG
FT                   VPRIITVSTLERSPLAVQVGLADEDVLAPWWPYLQASVAIVLAYIGVLLVLLYAVRRST
FT                   RRQQSMAEELKTGHAELRLAHQVGRVCTWYVDEDAALLRWSPLAREIFGVQTDALPVAD
FT                   FFARVHRDDAARLQHAFDQAFAGSAVLDQVFRLVLPGGEVRWVGARGQRVEVADSERRM
FT                   IGALTDLSERYQAREQMGEAERRFRLLFDRNPAPFWVFDPDTLRFIEVNDAAVRQYGYS
FT                   REEFLAMSILDIRPREGWDEVKGAIAKARVGELQDATVRLHRRKDGSVFEVRAHLSRLD
FT                   FDGQPACLVLAEDVSERLAYERDLAYQARHNPATGLLNVRALTEQLDEHDAGYTIAFVQ
FT                   LRGLQLVADTLGREIGDAVLQSMATRLGGLGARCGTLAFQPAEDFVFAIGAGQDVQRVL
FT                   DDLLQIVSAPMRGKDSLHQFEPRIGVATHVAGDGHSAEQVIGMAAQAAHAARAEGNVVV
FT                   WFDASVTTRLADRLRLAGRIHAAIDNEFQLYFQPIRHAGDGSPAALEALLRWPQADGSF
FT                   IPPNEFIPLCEDTGLILALGRWVIRAAAKAQRRLVDAGWGELPIAVNVSAVQFFNSDLV
FT                   TEFTRAQQDFGLARGALHVELTESSLMRKPAQAMQTMQRLHEQGISVSLDDFGTGYSSM
FT                   SYLQHLPLDILKIDRSFVADVETNPRNASICRALLSLGHSMGLTIIAEGVETPGQLDWL
FT                   AAHGCDQVQGYLLGRPAPLEQIIDALDEVPA"
     atgcggggcg gtgccaggcg tcaagaatgg cgtccgccgg ccgttgaggt cggggacgtg        60
     gaggattcgt tcgcgcatga agccagccga ctgcacaagg aagaccgacc gatgcccgcg       120
     ctgaagcggg cgttggctcg gccgttgcgc gccattacct ggggcggcgt gctgctgggc       180
     gtgttgctgg tggctggctt gaccaccatg ctggccaacg accaccaccg ccggctggag       240
     gctgcgcagc gccagagccg cgcgctggcg gtgggcagcg agcgcctgct ggcgctggaa       300
     ctgcgcaacc tggaacgggc gatgtccggt atcgccgccg acgcggccga actgttccgc       360
     cgcgtgccgg tacaggcgcc ggcactgctg gatgccgcca tcggcggcgt gctgagccgc       420
     catgccgagc tgcacagcat cgtggtgctg gaccgccacg gccgcgcgat caccgccggc       480
     aaaggcgatc tgaacctgcc gctgtggacc gacccgcagc ggcgcgggca gggcagcgcg       540
     ctgtacatcg gtccgccgca gcaggccggc gacgatggat gggtggtgcc gctggcgctg       600
     tcgatggccg acgatcgctg gctgctggcg cggctgcgct gcggcgaact gcagcgcatc       660
     atcggcgggc tggatgtggg cccgaacgga ctggtctcga tcagcgatgc cgagggttac       720
     atgctggcgc gggtgccgga tccgcatggc acggtcggcc gtcgcttcga cctgcctcgg       780
     cgtgacctgc tcggcaagca ggcggtggtc gagctgggca gcgtgccggg cgcggtcgat       840
     ggcgtgccac ggatcatcac cgtcagcacg ctcgagcgca gcccgctggc ggtgcaggtc       900
     gggttggccg atgaggacgt gctggcgccc tggtggccgt acctgcaggc gtcagtggcg       960
     atcgtgctgg cttacatcgg ggtgctgctg gtactgctgt acgcggtgcg ccgcagcacc      1020
     cgccgccagc agtcgatggc ggaggaactg aagaccggcc acgccgaact gcggctggcg      1080
     caccaggtgg gccgtgtctg cacctggtat gtggacgagg atgcggcact gctgcgctgg      1140
     tcgccgctgg cccgagagat tttcggggtg cagaccgatg cgctgccggt ggctgatttc      1200
     tttgcgcgcg tgcaccgtga tgacgccgcg cgcctgcagc acgccttcga ccaggcgttt      1260
     gccggtagtg cggtgctcga ccaggtgttc cggctggtgc tgcccggtgg cgaggtgcgc      1320
     tgggtcggtg cgcgtggcca gcgggtggag gtggctgaca gtgagcggcg catgatcggt      1380
     gcactgaccg acctgagcga gcgctaccag gcgcgtgagc agatgggcga agcggagcgt      1440
     cgcttccgcc tgctgttcga ccgcaacccg gcgccgttct gggtgttcga tccagacacg      1500
     ctgcgcttca tcgaggtcaa cgacgccgct gtgcgccagt atggctacag ccgcgaggaa      1560
     ttcctggcga tgagcatcct cgacatccgc ccgcgcgaag gctgggacga ggtgaagggc      1620
     gcgatcgcca aggcccgcgt cggcgagctg caggacgcca ccgtgcgcct gcaccggcgc      1680
     aaggatggca gcgtgttcga agtacgcgca cacctgtccc ggctcgactt cgatggacaa      1740
     ccggcgtgcc tggtgctggc cgaggatgtc agtgaacggc tggcttacga gcgcgacctg      1800
     gcctaccagg cgcggcacaa cccggccacc ggcctgctca acgtgcgcgc gctgaccgaa      1860
     cagctggacg agcacgatgc cggctacacc attgcgttcg tgcagctgcg cggcctgcag      1920
     ctggtggccg atacgctggg acgcgagatc ggcgatgcgg tgctgcagtc gatggccacc      1980
     cggctgggcg ggctgggcgc acgctgcggc acgctggcct tccagccggc agaggatttc      2040
     gtgttcgcca tcggcgccgg gcaggatgtc cagcgcgtgc tggacgacct gttgcagatc      2100
     gtgtcggcgc cgatgcgcgg caaggattcg ctgcaccagt tcgagccgcg tatcggcgtg      2160
     gcaacgcacg tggccggtga cgggcacagc gctgagcagg tgatcggcat ggcggcacag      2220
     gccgcgcatg cagcgcgcgc cgagggcaat gtggtggtct ggttcgacgc gtcggtgacc      2280
     acgcggctgg ccgaccgcct gcgcctggcc gggcgcatcc atgccgccat cgacaacgag      2340
     ttccagctgt acttccagcc gatccggcac gccggcgatg gcagcccggc agcgctggag      2400
     gcgctgctgc gctggccgca ggcggacggt agtttcattc cgcccaacga gttcatcccg      2460
     ttgtgcgaag acaccggact gatcctggcg ctggggcgct gggtgatccg cgcggcggcg      2520
     aaggcgcagc ggcggctggt cgatgccggt tggggcgagc ttccgatcgc ggtcaacgtg      2580
     tcggcggtgc agttcttcaa cagtgacctg gtaaccgagt tcacgcgcgc gcagcaggac      2640
     ttcggcctgg cccgcggcgc gctgcacgtg gagctgaccg agagcagcct gatgcgcaag      2700
     ccggcgcagg cgatgcagac catgcagcgc ctgcacgagc agggcatcag cgtgtcgctg      2760
     gatgatttcg gtaccggcta ctcgagcatg tcctacctgc agcacctgcc gctggacatc      2820
     ctgaagatcg accgcagctt cgttgccgac gtggaaacca acccacgcaa tgcctcgatc      2880
     tgccgcgcgc tgctgtcgct gggccacagc atggggctga ccatcatcgc cgagggcgtg      2940
     gaaacgccgg ggcagctgga ctggctggcc gcgcacggct gtgaccaggt acagggctat      3000
     ctgctgggcc ggccggcgcc gctggagcag atcatcgacg cgctggatga ggttccggcc      3060
     tag                                                                    3063
//

If you have problems or comments...

PBIL Back to PBIL home page