(data stored in ACNUC7421 zone)

EMBL: CP001111.PE43

CP001111.PE43        Location/Qualifiers
FT   CDS_pept        50800..51132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_4252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49748"
FT                   /db_xref="GOA:B4SR47"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR47"
FT                   /protein_id="ACF49748.1"
FT                   /translation="MRAGYGVLLAVLLPGVALAQVTDTTSYLQRMDSDGDGRVSESEYV
FT                   QWMLYAFDRMDRNGDGVLGADELPGGKGRVITREQQRQVIVQRFHKQDANGDGFLDARE
FT                   LSAPPR"
     gtgagggcag ggtacggggt tctgcttgcg gtgctgctgc cgggcgtggc gctggcccag        60
     gtcaccgaca caaccagcta cctgcagcgg atggacagcg atggcgacgg ccgggtcagc       120
     gagtccgagt acgtgcagtg gatgctgtat gccttcgacc gcatggaccg caatggcgat       180
     ggcgtgcttg gcgccgatga gctgccgggc ggcaagggca gggtgatcac ccgtgagcag       240
     cagcggcagg tgatcgtgca gcgcttccac aagcaggatg ccaacggtga tggcttcctg       300
     gatgcgcgcg agctgtcggc accgccgcgc tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page