(data stored in ACNUC7421 zone)

EMBL: CP001111.PE436

CP001111.PE436       Location/Qualifiers
FT   CDS_pept        complement(519163..519438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50141"
FT                   /db_xref="InterPro:IPR025109"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID6"
FT                   /protein_id="ACF50141.1"
FT                   /translation="MSVYVDDAVHPWRGQRWAHLMADTLTELHAMAAQLGIAPRAFQNK
FT                   ASGAHYDVTADLRAQAIALGARAISRHTDRALVKAVIATARAQYRP"
     gtgtcggtct acgtcgatga cgcggtgcat ccctggcgcg gtcagcgctg ggcgcacctg        60
     atggccgaca ccttgaccga gctgcacgcc atggcggcgc agctcggcat tgcaccgcgg       120
     gccttccaga acaaggccag cggcgcgcat tacgatgtca ctgcagacct gcgtgcgcag       180
     gcaatcgcgc tgggtgcccg ggcgatttcc cggcataccg accgcgcgct ggtaaaagcc       240
     gtgatcgcca ccgccagggc gcagtaccgg ccgtag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page