(data stored in ACNUC7421 zone)

EMBL: CP001111.PE437

CP001111.PE437       Location/Qualifiers
FT   CDS_pept        complement(519452..519964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV3816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50142"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID7"
FT                   /protein_id="ACF50142.1"
FT                   /translation="MSQNSKAKRDKRKKQQAKRPFLRLNAREQVQNHAVLLSEDGQAVA
FT                   AIGLQGREWLLAIGGQTMGNADNPVPMLAMLKHLSNMQEAEGRTVTLEYSELMQKLLDT
FT                   LAAEAGQTAEEYLDKLVAEFASEQAEDAAAEGEAAADDAAAETTGAEGAADAEATPAAD
FT                   ADGKPQA"
     atgtcccaga actccaaggc caagcgcgac aagcgcaaga agcagcaggc caagcgtccg        60
     ttcctccgtc tgaacgcgcg cgagcaggtg cagaaccatg ccgtgctgct cagcgaagac       120
     ggccaggccg tggccgccat cggcctgcag ggccgtgagt ggctgctggc catcggtggc       180
     cagaccatgg gcaacgccga caacccggtg ccgatgctgg ccatgctcaa gcacctgtcg       240
     aacatgcagg aagccgaagg ccgcacggtc accctggagt actccgagct gatgcagaag       300
     ctgctggaca ccctggccgc tgaagccggc cagaccgccg aggagtacct ggacaagctg       360
     gtagccgagt tcgccagcga gcaggccgaa gacgcagccg ctgaaggcga agcagctgcc       420
     gatgacgctg ctgcagagac caccggcgcc gaaggcgctg ccgacgccga ggccaccccg       480
     gccgccgacg ccgacggcaa gccgcaggcc tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page