(data stored in ACNUC7421 zone)

EMBL: CP001111.PE438

CP001111.PE438       Location/Qualifiers
FT   CDS_pept        complement(520096..521052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0438"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: xom:XOO_0624
FT                   flagellar motor protein MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50143"
FT                   /db_xref="GOA:B4SID8"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID8"
FT                   /protein_id="ACF50143.1"
FT                   /translation="MAETKPTVIVRRVRKAGHAAHHGGSWKVAYADFVTAMMAFFLVLW
FT                   LMASTSKPERAAISEYFRNPSPLVGSSATPAPGMAGPGGASTSMIKLGGATDISRGSSN
FT                   DPFQNQKEAVPQPVDQQQRDKQQLEALMKELQEAISRSQALEPFKDQLLLDLTPEGLRI
FT                   QIVDKQNRPMFDLGSATLKPYTQQILHELAEYLNHVPNRISLTGHTDITAYSAARGYGN
FT                   WELSADRANAARRALIDGGLEDSKITRVVGLSSSVLFDKADPQNPINRRISIVVMTQAA
FT                   EQAALAGAGPQVGLSATTADPDVQAAQGEAATSAVTP"
     atggccgaaa ccaagcccac cgtcatcgtc cgccgggtca ggaaggccgg ccacgccgcc        60
     caccatggcg gttcgtggaa ggtcgcctac gccgacttcg tgaccgcgat gatggccttc       120
     ttcctggtgc tgtggctgat ggccagcacc agcaagccgg aacgggcagc tatttccgaa       180
     tacttccgca accccagccc cttggtcggt tccagtgcca cccccgcacc gggcatggcc       240
     ggcccgggtg gcgccagcac ctcgatgatc aagctgggtg gtgccaccga catctcgcgg       300
     ggcagcagca acgatccctt ccagaaccag aaggaagccg tgccgcagcc ggtggaccag       360
     cagcagcgcg acaagcagca gctggaagcg ctgatgaagg aactgcagga agcgatcagc       420
     cggagccagg cactggaacc gttcaaggac cagctgctgc tggacctgac cccggaaggc       480
     cttcgcatcc agatcgtgga caagcagaac cggccgatgt tcgacctcgg cagcgccacg       540
     ctgaagccgt acacccagca gatcctgcac gagctggccg aatacctgaa ccacgtgccg       600
     aaccggatca gcctgaccgg ccacaccgac atcaccgcct attcggccgc gcgcggctac       660
     ggcaactggg aactgagtgc cgaccgcgcc aacgccgcac gacgtgcgct gatcgatggc       720
     ggcctggaag acagcaagat cacccgcgtg gtcggcctgt cctcgtcggt gctgttcgac       780
     aaggccgacc cgcagaaccc gatcaaccgc cgcatcagca tcgtggtgat gacccaggcc       840
     gccgaacagg ccgcactggc cggtgccggc ccgcaggtgg ggctgtcggc caccaccgcc       900
     gacccggatg tgcaggcggc gcagggtgag gccgcaacct cggccgtgac cccctga          957
//

If you have problems or comments...

PBIL Back to PBIL home page