(data stored in ACNUC7421 zone)

EMBL: CP001111.PE441

CP001111.PE441       Location/Qualifiers
FT   CDS_pept        522610..522978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50146"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE1"
FT                   /protein_id="ACF50146.1"
FT                   /translation="MKPTLSLLLALLPTLALAQVPTGNPTATRSTTTVAPQPVVPPVQP
FT                   ARPQPQVLPSPQPAQPIKSTGPAQIAPVPAPKPSSKVYDRNGRIIPGVRPAGPNRVFDS
FT                   RTGRYYDSVPSGDGQQIR"
     atgaaaccga ccctttccct gctgctggcc ctgctgccca cgctggcgct ggcccaggtg        60
     ccgaccggta atccgaccgc cacccgcagc accaccaccg tagcccccca gccggtggtg       120
     ccgcccgtgc agccagcgcg gccgcagcca caggtactgc cttcgccgca gccggcacag       180
     ccgatcaagt ccaccggtcc ggcccagatt gcgccggttc cggcgccgaa gccgtccagc       240
     aaggtctacg accgcaacgg ccgcatcatc ccgggggtgc gcccggctgg ccccaaccgc       300
     gtgttcgatt cgcgcaccgg ccgctattac gacagcgtgc ccagtggtga cggtcagcag       360
     atccggtag                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page