(data stored in ACNUC7421 zone)

EMBL: CP001111.PE446

CP001111.PE446       Location/Qualifiers
FT   CDS_pept        complement(526518..527081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50151"
FT                   /db_xref="InterPro:IPR021557"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE6"
FT                   /protein_id="ACF50151.1"
FT                   /translation="MKRSLAIALLAGALVAGGANAAPRTVTDAQAPRTLQADGPVNVKW
FT                   DDPAKFTEIRQSSNRFEAERGDWVQQLARYLQTTAAKPLQPGQTLDVTLVDVKRAGDYE
FT                   PWHGPRGRDIRIMRDIYPPRISLQYTLKDASGRIISEGDARLSDTGYLHNVGLKSDSDP
FT                   LRYEKRLIDDWVKRQLTSQATAAR"
     atgaaacgct cactcgcgat tgccctgctg gcaggcgccc tggtggcggg tggcgcaaat        60
     gcggccccgc gcaccgtgac cgatgcgcag gcaccacgca ccctgcaggc cgatggcccg       120
     gtcaacgtga aatgggatga tccggccaag ttcaccgaga tccgccagag cagcaaccgc       180
     ttcgaagccg agcgcggcga ctgggtgcag cagctggcgc gctacctgca gaccacggca       240
     gccaagccgc tgcagcccgg tcagaccctc gatgtgaccc tggtcgacgt caagcgcgcc       300
     ggtgattacg agccgtggca cggcccgcgt gggcgcgaca tccggatcat gcgtgacatc       360
     tacccgccgc ggatcagcct gcagtacacg ctgaaggatg ccagcggccg catcatcagc       420
     gaaggcgatg cgcgcctgag cgacaccggc tatctgcaca acgtggggct gaagagcgac       480
     agtgatccgc tgcgctacga gaagcgcctg atcgatgact gggtgaagcg gcagctgacc       540
     agccaggcca ccgcggcgcg gtag                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page