(data stored in ACNUC7421 zone)

EMBL: CP001111.PE448

CP001111.PE448       Location/Qualifiers
FT   CDS_pept        529358..529651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50153"
FT                   /db_xref="InterPro:IPR021649"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE8"
FT                   /protein_id="ACF50153.1"
FT                   /translation="MSRIAPRIHTDPAQIARLEALLPQLEGETQVELTLQDGRRLLGTI
FT                   AVKPTVQQYRNDAGDEGSNGQLRLDDYDTPVQQHHVWLDEIASIRRLPPKAP"
     atgtcccgta tagctccccg tatccatacc gatccggcgc agatcgcgcg cctggaagcc        60
     ctgctgccgc agctggaagg cgaaacgcag gtggaactga ccctgcagga cggtcgccgg       120
     ctgctcggca ccattgcagt gaagccgacc gtgcagcagt accgcaacga tgccggcgac       180
     gaaggcagca acggccagct gcgcctggac gactacgaca cgccggtgca gcagcatcat       240
     gtgtggctgg atgagatcgc cagcatccgc aggttgccgc caaaggcacc ttga             294
//

If you have problems or comments...

PBIL Back to PBIL home page