(data stored in ACNUC7421 zone)

EMBL: CP001111.PE449

CP001111.PE449       Location/Qualifiers
FT   CDS_pept        complement(529737..530000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50154"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE9"
FT                   /protein_id="ACF50154.1"
FT                   /translation="MRALFVGGVVDNSEMDLEGSHPPVHYPEDTGGGHSRYRLHQVGHG
FT                   ADGSVAYAVYGAPDLADDEVARVAEERAYARRFEATPTLFEH"
     atgcgagcct tgttcgtcgg tggcgtggtc gacaacagcg aaatggacct ggaaggcagc        60
     catccgcccg tgcattaccc cgaagacacc ggcggcggcc actcacgcta ccgcctgcac       120
     caggtcggcc acggcgccga tggcagcgtg gcctacgcgg tctacggcgc gccggacctg       180
     gccgacgacg aggtggcgag ggtggcggaa gaacgcgcct atgcgcgcag gttcgaagcg       240
     acgccgacgt tgttcgagca ttga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page