(data stored in ACNUC7421 zone)

EMBL: CP001111.PE45

CP001111.PE45        Location/Qualifiers
FT   CDS_pept        52216..53028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0045"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: xcb:XC_4239 formamidopyrimidine-DNA
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; DNA glycosylase/AP lyase, H2TH DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49750"
FT                   /db_xref="GOA:B4SRN0"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SRN0"
FT                   /protein_id="ACF49750.1"
FT                   /translation="MPELPEVETTRRGLAPHLQGRRVHGVILRRADLRWPIPPEVAGQL
FT                   PGQRIDAVRRRAKYLLLDTAAGSAVLHLGMSGSLRVLPGDTPLRAHDHVDISLDNGRLL
FT                   RFNDPRRFGSLLWQPAGEVHPLLQGLGPEPLDDAFDGNYLFARSRGRSAPVKTFLMDQA
FT                   VVVGVGNIYAAESLFKAGISPLREAGKISRERYQRLADAVKEILGYAITRGGTTLRDFI
FT                   SPDGAPGYFEQELLVYGRDGLPCPNCGRALKHATIGQRASVWCSHCQR"
     atgcccgagc tgcccgaagt cgaaaccacc cgccgcggcc tggcgccgca tctgcagggc        60
     cgccgcgtgc acggggtgat cctgcgccgc gccgacctgc gctggcccat cccgccggag       120
     gtggccgggc agttgccggg ccagcgcatc gacgcggtgc gtcgccgtgc caagtacctg       180
     ttgctggata ccgccgcagg cagtgccgtg ctgcacctgg gcatgtccgg cagcttgcgc       240
     gtgctgccgg gtgacacgcc gttgcgcgcg cacgaccatg tggacatcag cctggacaac       300
     ggccgcctgc tgcgcttcaa cgacccgcgc cgctttggca gcctgctctg gcagccggcc       360
     ggcgaggtgc accctctgct gcaggggctg ggaccggaac cgctggacga cgccttcgac       420
     ggcaactacc tgttcgcccg cagccgtggc cgcagcgcgc cggtgaagac cttcctgatg       480
     gaccaggcgg tggtggtggg cgtgggcaac atctacgccg ccgagagcct gttcaaggcc       540
     ggcatcagtc cgctgcgcga ggcaggaaag atctcgcgcg aacgctacca gcggctggcc       600
     gacgcggtga aggaaatcct cggctacgcc atcacccgtg gcggcaccac cctgcgcgat       660
     ttcatcagcc ctgacggcgc accgggctac ttcgaacagg aactgctggt gtacggccgc       720
     gacgggctgc cctgcccgaa ctgtggccgc gcgctgaagc acgccaccat cggccagcgc       780
     gccagcgtct ggtgcagcca ctgccagcgc tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page