(data stored in ACNUC7421 zone)

EMBL: CP001111.PE450

CP001111.PE450       Location/Qualifiers
FT   CDS_pept        530159..531229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0450"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 12; KEGG: xac:XAC3679 ribosomal RNA small subunit
FT                   methyltransferase C"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50155"
FT                   /db_xref="GOA:B4SIF0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIF0"
FT                   /protein_id="ACF50155.1"
FT                   /translation="MASSDDAPLQTLLLPFSQGALRWPEGPVAFLRARDGWPLREVAGG
FT                   REVHCEQSFAPFAQPLQQAAGWTVSGQLDDEAGKGRYPLVLVLPPRQREEARALFARAL
FT                   ALVAEGGRIVACQSNNEGARSGEGDLKQLTGLGGSLTKNHCRAYWTAPMQGQHDADLAK
FT                   RWSALDAVRPIVGGRFLSRPGVFAWDRIDPASALLAEHLPADLAGRAADLGAGYGYLSR
FT                   ELLERCPEITALDLYEAEQRALALAELNLSPPPRPLPLRFLWRDVTAGIEPDYDVIISN
FT                   PPFHTPSRADRPDIGQRFIAVAAQALRPGGRLYVVANRHLPYEYTLNESFGAVRVVAER
FT                   DGFKLVEAVKGRGKGK"
     atggcctcca gcgacgacgc ccccctgcag accctgctcc tgccgttctc ccaaggcgcc        60
     ctgcgctggc cggagggccc ggtggccttc ctgcgtgccc gcgatggctg gccgctgcgc       120
     gaagtggccg gtggccgtga agtgcactgc gagcagagct tcgccccgtt cgcgcagccg       180
     ctgcagcaag ccgccggctg gaccgtcagc ggtcagctgg atgatgaagc cggcaagggc       240
     cgctatccgc tggtgctggt gctgccgccg cgccagcgcg aggaagcccg tgcgctgttc       300
     gcccgcgccc tggcgctggt tgccgaaggc ggccgcatcg tcgcctgcca gtccaacaac       360
     gaaggcgcgc gttccggcga gggcgacctc aagcagctga ccggcctcgg cggcagcctg       420
     accaagaacc actgccgggc gtactggacc gcgccgatgc agggccagca cgatgccgac       480
     ctggccaagc gctggtccgc cctggacgcg gtccgcccga ttgtcggtgg ccgcttcctc       540
     agccggccgg gcgtgttcgc ctgggaccgg atcgatccgg cctcggcgct gctggccgag       600
     cacctgccgg ccgacttggc cggtcgcgcc gccgacctcg gtgccggcta cggctacctg       660
     tcgcgcgagc tgctggaacg ctgcccggag atcaccgcgc tggacctgta cgaggccgag       720
     cagcgtgcgc tggcgctggc cgagctgaac ctgtcgccgc cgccgcgccc gctgccgctg       780
     cgcttcctgt ggcgcgacgt caccgccggc atcgagccgg attacgacgt catcatcagc       840
     aacccgccgt tccacacgcc ctcgcgtgcc gaccgtccgg acatcggcca gcgcttcatc       900
     gccgtggccg cgcaggcgct gcgcccgggc gggcgcctgt acgtggtggc caaccgccac       960
     ctgccgtacg aatacacgct caatgagagt ttcggtgcgg tgcgcgtggt tgccgagcgc      1020
     gatggcttca agctggtcga ggcagtgaag ggcaggggga agggcaagtg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page