(data stored in ACNUC7421 zone)

EMBL: CP001111.PE452

CP001111.PE452       Location/Qualifiers
FT   CDS_pept        531924..532607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0452"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: xcb:XC_3708 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50157"
FT                   /db_xref="GOA:B4SIF2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIF2"
FT                   /protein_id="ACF50157.1"
FT                   /translation="MTTIAALPFLPDAIIFDMDGLMIDSERVSLACWSQAADEFGLGLD
FT                   ETVFLRMVGLGDRDTHALLRVQGVEDSVIEAVAARCHDLYEERTQTGLPLRPGILELLE
FT                   LLKAHAIPRAVATTTRQPRANRKLSAAGLLPYFDAVITSGDVARPKPAPDIYLLAAQRL
FT                   GQVPERCLALEDSPAGTRAALAAGMTVIQVPDLVHPDEELRAFGHRIVGSLLDAHALLV
FT                   PLLPK"
     atgaccacca tcgctgcgct gccgttcctg cccgacgcca tcatcttcga catggacggc        60
     ctgatgatcg acagcgagcg ggtctcgctt gcctgctgga gccaggccgc cgatgagttc       120
     ggcctgggcc tggacgaaac ggtgttcctg cgcatggtcg gactcggcga ccgcgatacg       180
     cacgcgttgc tgcgtgtgca gggtgtcgag gacagcgtga tcgaagccgt ggccgcacgc       240
     tgccacgatc tctacgagga acgcacgcag accggcctgc cgctgcggcc gggcatcctg       300
     gagctgctgg aactgctgaa ggcgcacgcg ataccgcgtg cggtggcaac caccacgcgg       360
     cagccgcggg ccaaccgcaa gctgtccgcc gccggcctgc tgccgtattt cgatgcggtg       420
     atcaccagcg gcgacgtggc acggccgaag ccggcgccgg acatctacct gctggccgcg       480
     cagcggctgg gccaggtgcc cgagcgctgc ctggcgctgg aagactcacc ggccggcacg       540
     cgcgcagcgc tggctgccgg catgaccgtg atccaggtgc cggacctggt gcatccggac       600
     gaagagctgc gcgcattcgg acaccgcatc gtcggctcgc tgctggacgc gcacgcgctg       660
     ctggtgccgt tgctgccgaa ataa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page