(data stored in ACNUC7421 zone)

EMBL: CP001111.PE454

CP001111.PE454       Location/Qualifiers
FT   CDS_pept        complement(533943..534458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0454"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA"
FT                   /EC_number="4.2.1.59"
FT                   /note="KEGG: xcb:XC_3651 3-hydroxydecanoyl-(acyl carrier
FT                   protein) dehydratase; TIGRFAM:
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA;
FT                   PFAM: Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50159"
FT                   /db_xref="GOA:B4SIF4"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SIF4"
FT                   /protein_id="ACF50159.1"
FT                   /translation="MTRLHAFNREQLLASARGELFGAAAGRLPNDPMLMFDRITEIRED
FT                   GGPHGKGMVRAELDIRPDLWFFGCHFIGDPVMPGCLGLDAMWQLTGFFLTWLGAPGKGR
FT                   ALGCGEVKFTGQVLPDAKLVRYEIDISRVINRKLVMAQSDARMYVDDREIYSARDLRVG
FT                   LFTETGSF"
     atgacccgtc tccacgcgtt caaccgcgaa cagctgctgg ccagcgcacg cggtgaactg        60
     ttcggcgccg ctgccggccg tttgcccaac gatccgatgc tgatgttcga ccgcatcacc       120
     gaaatccgcg aggacggcgg accgcatgga aagggcatgg tacgcgccga actggatatc       180
     cgccccgacc tctggttctt cggctgccac ttcatcggcg acccggtgat gcctggttgc       240
     ctgggcctgg atgccatgtg gcagctgacc ggcttcttcc tgacctggct gggtgccccc       300
     ggcaagggcc gtgctctggg ctgcggcgag gtgaagttca ccggccaggt gctgccggat       360
     gcgaagctgg tgcgttacga gatcgacatc agccgggtca tcaaccgcaa gctggtgatg       420
     gctcagtcgg acgcccgcat gtacgtggat gaccgcgaaa tctacagcgc gcgcgatctg       480
     cgcgtcggcc tgttcactga aaccgggagc ttctga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page