(data stored in ACNUC7421 zone)

EMBL: CP001111.PE456

CP001111.PE456       Location/Qualifiers
FT   CDS_pept        complement(535982..536893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0456"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pfo:PflO1_4474 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50161"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIF6"
FT                   /protein_id="ACF50161.1"
FT                   /translation="MRTAALLLPLALAATFTSAPLLAAPATAAPATVTKSQLHLQTFHP
FT                   GPQAMFSVSSVLVEGRHDAILVNAQFGASDARKLVDLIRASGKQLTTIYISHGDPDYYF
FT                   GLATLQDAFPQARIVATAQTVAHIQQTQAGKLAYWGPKMGADVPARIVVPQVLDGDALQ
FT                   LEGQRLPLIGLDGPSPDRTVLWVPTLRAIVGGIPVVAGEHVWMADTQTPKSHADWLQTL
FT                   QRLQALKPKVVVPGHYAPGAALDASALRFTADYIRAFDVEAAKAKDSAALVKAMQSRYP
FT                   KLAGVASLELSAKVAKGEMQWP"
     atgcgtaccg ctgccctgct gcttcccctc gccctggccg ccaccttcac cagtgcgccg        60
     ctgctggccg caccggccac cgcggcgccg gccacggtga cgaaatccca gctgcacctg       120
     cagaccttcc atcccggccc gcaggcgatg ttctcggtgt cctcggtgct ggtcgaaggc       180
     cgccacgatg cgatcctggt caacgcacag ttcggcgcca gcgatgcgcg caagctggtg       240
     gatctgatcc gcgccagcgg caagcagctg accacgatct acatcagcca cggcgatccg       300
     gattactact tcggcctggc cacgctgcag gacgcgttcc cgcaggcgcg catcgtcgcc       360
     actgcgcaga ccgtcgctca catccagcag acccaggccg gcaaactggc ctactgggga       420
     ccgaagatgg gcgccgacgt gccggcgcgc atcgtggtgc cgcaggtgct ggacggcgat       480
     gccctgcaac tggaaggcca gcgcctgccg ctgatcggcc tcgatggccc gtccccggac       540
     cgcacggtgc tatgggtgcc gacgctgcgc gcgatcgtcg gtggcattcc ggtggtggcg       600
     ggcgaacacg tgtggatggc cgacacgcag accccgaagt cgcacgccga ctggctgcag       660
     accctgcagc ggctgcaggc actgaagccg aaggtggtgg tgccggggca ttacgcgccg       720
     ggtgcggcac tggatgccag tgcgctgcgc ttcaccgcag actacatccg tgcgttcgat       780
     gttgaggcgg caaaggcgaa ggacagtgcg gcgctggtga aggcgatgca gtcgcgctat       840
     ccgaagctgg caggcgtggc gtcgctggag ctgagtgcga aggtggccaa gggcgagatg       900
     cagtggccat ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page