(data stored in ACNUC7421 zone)

EMBL: CP001111.PE46

CP001111.PE46        Location/Qualifiers
FT   CDS_pept        53134..54738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0046"
FT                   /product="periplasmic glucan biosynthesis protein MdoG"
FT                   /note="PFAM: periplasmic glucan biosynthesis protein MdoG;
FT                   KEGG: xcv:XCV4387 glucan biosynthesis protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49751"
FT                   /db_xref="GOA:B4SRN1"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023724"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SRN1"
FT                   /protein_id="ACF49751.1"
FT                   /translation="MQRRDFIRNASLALAAFGLPSLPACAASKSGQMGLRRLGQPQPFD
FT                   FATLKGQARALAQAPYKSHKRVLPGRLEGLDWDQYQSIGYRQDHALWADQPGKFQAKFF
FT                   HLGLYFHSPVRMFDVVDGKAQELAYDGAAFNYGKSGIKDGELPADLGFAGFRLNTRKDT
FT                   DRDFAAFLGASYFRAVGKEGQYGQSARGLAIDTGMGKPEEFPDFIAYYLEQPSADSETI
FT                   VVYGLLDSPSVAGAYRFAITNGDVLLMDIDSALYPRKAIERLGIAPCTSMYQVGENDRR
FT                   MAWDWRPEIHDTDGLSLWTGAGEWIWRPLLNPRNLRFNMFVDRNPRGFGLLQRDRNFDH
FT                   YQDDGVFYEKRPCLWVEPKGEWGEGSVQLVEIPTVDETFDNIVAFWNPKEKPQPGQELL
FT                   VGYRLYWGAEPPARPPLAHCVASRTGLGGVVGKKREYFSWRFAVDFEGGELARLIDKGE
FT                   VEAVVEASRGRVEIVSARPLREINGYRAMFDLVPPEGSTEQIDIRLFLRSGGKTLTETW
FT                   LYQYTPPPAGAPERTLY"
     atgcaacgac gcgacttcat ccgcaatgcc tccctcgccc tggctgcatt cggcctgccg        60
     tccctgcccg cgtgcgcggc cagcaagagc ggccagatgg gcctgcgccg cctcggccag       120
     ccgcagccgt tcgacttcgc caccctgaag ggccaggcgc gcgcgctggc acaggcaccc       180
     tacaagagcc acaagcgggt gctgcctggg cgtctggaag gcctggactg ggaccagtac       240
     cagtcgatcg gctaccgcca ggaccatgca ctgtgggctg accagccggg caaattccag       300
     gccaagttct tccacctggg cctgtacttc cactcgccgg tgcgcatgtt cgacgtggtc       360
     gacggcaagg cgcaggagct ggcctatgac ggcgcggcgt tcaactacgg caagagcggc       420
     atcaaggacg gcgagctgcc ggccgatctg ggcttcgccg gcttccgcct gaacacccgc       480
     aaggacaccg accgcgactt cgccgccttc ctcggcgcca gctacttccg cgcggtcggc       540
     aaggaaggcc agtacggcca gtccgcgcgc ggcctggcga tcgacaccgg catgggcaag       600
     ccggaggaat tcccggactt catcgcctac tacctggagc agccatcggc cgattcggag       660
     acgatcgtgg tctacggcct gctggattcg cccagcgtgg ccggtgccta ccgcttcgcc       720
     atcaccaatg gtgatgtgct gctgatggac atcgacagcg cgctgtaccc gcgcaaggcg       780
     atcgagcggc tgggcatcgc cccgtgcacc agcatgtacc aggtgggcga gaacgaccgc       840
     cgcatggcat gggactggcg cccggagatc cacgacaccg atggcctgtc gctgtggacc       900
     ggtgccggcg aatggatctg gcgaccgctg ctgaatccgc gcaacctgcg cttcaacatg       960
     ttcgtcgacc gcaacccgcg tggtttcggc ctgctgcagc gcgaccgcaa cttcgaccac      1020
     taccaggacg acggcgtgtt ctacgagaag cgcccctgcc tgtgggtgga gccgaagggc      1080
     gaatggggcg agggctcggt gcagctggtg gagattccca ccgtggacga gaccttcgac      1140
     aacatcgtgg cgttctggaa cccgaaggaa aagccgcagc cgggccagga gctgctggtc      1200
     ggctaccgcc tgtactgggg cgccgaaccg ccggcacggc cgccgctggc gcactgcgtg      1260
     gccagccgca ccggcctggg cggcgtggtc ggcaagaagc gcgagtattt cagctggcgc      1320
     ttcgcggtgg acttcgaagg cggcgaactg gcgaggctga tcgacaaggg cgaggtcgag      1380
     gccgtggtgg aagccagccg cggccgggtc gagatcgtgt cggcgcgccc gctgcgcgag      1440
     atcaacggct accgcgcgat gttcgacctg gtgccgccgg agggcagcac cgagcagatc      1500
     gacatccgcc tgttcctgcg cagtggcggc aagaccctta ccgagacctg gctgtaccag      1560
     tacaccccgc cgccggcggg tgcgccggag cgcacgctgt actaa                      1605
//

If you have problems or comments...

PBIL Back to PBIL home page