(data stored in ACNUC7421 zone)

EMBL: CP001111.PE461

CP001111.PE461       Location/Qualifiers
FT   CDS_pept        complement(540306..542147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0461"
FT                   /product="TonB-dependent vitamin B12 receptor"
FT                   /note="TIGRFAM: TonB-dependent vitamin B12 receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: xcb:XC_1091 outer membrane receptor for transport of
FT                   vitamin B"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50166"
FT                   /db_xref="GOA:B4SIG1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG1"
FT                   /protein_id="ACF50166.1"
FT                   /translation="MKLQSRMLSLAVLAALPALAQAADDTTALDQILVTATRTPIALQY
FT                   SIAPAQVIDRAQIESSQATSLQELLRGRAGINLTNAGGLGKQSSLFLRGTNSGHTVVLV
FT                   DGVRINSADLGLAMYQDLPLAQIERVEIVRGPQSSLYGADAIGGVIQIFTRRNQGDFAP
FT                   HFQLGGGSNGLREASGGIGGGTERGWFGADIAYQHSDGIDACRGSATLFAGCFADEPDR
FT                   DGYRNLSKSLRGGYSFNDQWNVEGSALRADGKNHYDGYYNYSETRQQVLAGKVRYTPSE
FT                   RLAFTANVGRSDNESDNFGAPGVFGSAQTHRDSASLQGDITLAEGQLLSTGVDWSEDNL
FT                   DGSSAGYLVDSRRNTGVFVQYQGRFGRHQLQVSARNDDNQQFGNHATGSVGWAMELEHG
FT                   LRVNASYGTAFKAPTFSDLYDPWSGVPTLNPEKSKSANLGVSQHGKGWHWGLDVYETRI
FT                   DDLITYDASTMKMQQVEKARIRGAELTGGVLLAGFDINAQLSYTDPRNRTHGSTQFDNW
FT                   LPRRAQQTARLDIDRRFGDFRAGLTVQGAGKRYDDAANAVKVGGYGTLDLRAEYALTPE
FT                   WSLLARAANVFDRRYETVAWFNQPGREYQLSVRYQPK"
     atgaagctgc agtcccgaat gctgtccctg gccgtgctcg ccgcccttcc cgcgctggcc        60
     caggccgccg atgacaccac cgcgcttgac cagatcctgg tcaccgccac ccgcaccccg       120
     atcgccctgc agtacagcat cgcgccggcg caggtaatcg accgcgcgca gatcgaatcc       180
     agccaggcca cctcgctgca ggagctgctg cgcggccgcg caggcatcaa cctgaccaat       240
     gctggcggcc tcggcaagca gagctcgctg ttcctgcgcg gcaccaactc cggccacacc       300
     gtggtgctgg tggatggcgt gcgcatcaac agcgccgatc tcggcctggc catgtaccag       360
     gacctgccgc tggcgcagat cgagcgcgtc gaaatcgtac gcggcccgca gtcgagcctg       420
     tacggtgccg atgccatcgg cggcgtgatc cagatcttca cccgccgcaa ccagggcgac       480
     ttcgccccgc acttccagct cggtggcggc agcaatggcc tgcgcgaagc cagcggcggc       540
     atcggcggtg gtaccgagcg cggctggttc ggcgccgaca tcgcctacca gcactccgac       600
     ggcatcgatg cctgccgcgg ctcggccacg ctgttcgccg gctgcttcgc agacgaaccc       660
     gaccgcgacg gctaccgcaa cctgtccaag agcctgcgtg gcggctacag cttcaacgac       720
     cagtggaacg tggaaggcag cgcgctgcgc gccgacggca agaaccacta cgacggttac       780
     tacaactact cggaaacccg ccagcaggtc ctggccggca aggtgcgcta caccccgtcc       840
     gaacgcctgg cattcactgc caacgtcggc cgcagcgaca atgaatccga caacttcggt       900
     gcaccagggg tgtttggcag cgcgcagacc catcgtgaca gcgcctcgct gcagggtgac       960
     atcacgctgg ccgaaggtca gctgctgagc accggcgtgg actggagtga ggacaacctg      1020
     gatggcagca gcgccggata tctggtcgac agccgccgca acaccggcgt gttcgtgcag      1080
     taccagggcc gcttcggccg ccatcagctg caggtcagcg cgcgcaacga cgacaaccag      1140
     cagttcggca accatgccac cggcagcgtg ggctgggcga tggaactgga gcacggcctg      1200
     cgcgtcaatg ccagctacgg cacggcgttc aaggcaccga ccttcagtga cctgtatgac      1260
     ccgtggagcg gcgtgccaac gttgaacccg gaaaagtcca agagcgcaaa cctcggcgtt      1320
     tcgcagcacg gcaaaggttg gcactggggc ctggacgtat acgagacccg cattgatgac      1380
     ctgatcacct acgatgcgtc cacaatgaaa atgcagcagg tggagaaggc acgcatccgt      1440
     ggcgccgagc tgaccggtgg cgtgctgctg gccggtttcg acatcaatgc gcagctaagc      1500
     tacaccgacc cacgcaaccg cacccacggc agcacccagt tcgacaactg gctgccgcgc      1560
     cgcgcgcagc agaccgcgcg cctggacatt gaccgccgct tcggtgattt ccgcgccggc      1620
     ctgaccgtgc agggtgcggg caagcgctat gacgatgccg ccaacgcagt gaaggtcggc      1680
     ggctacggca cgctggacct gcgcgccgag tacgcgctga cgccggagtg gtcgctgctg      1740
     gcgcgtgccg ccaacgtgtt cgaccgccgc tacgagacgg tggcgtggtt caaccagcct      1800
     ggtcgcgagt accagctgag cgtgcgttac cagccgaagt ga                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page