(data stored in ACNUC7421 zone)

EMBL: CP001111.PE466

CP001111.PE466       Location/Qualifiers
FT   CDS_pept        complement(544961..546403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0466"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: cvi:CV_1900 probable transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50171"
FT                   /db_xref="GOA:B4SIG6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG6"
FT                   /protein_id="ACF50171.1"
FT                   /translation="MDTDDQSAMIPPRYQRLSDELAEAIHGGRLPVGSRLPSLRQMASQ
FT                   RRLSLNTVIAAYRQLEDAGLVIPRPKAGFEVAPRLSVPQRSLRDTPSAPTAPLQQVLMA
FT                   RVLEAQRRAGVIDLAFAGPRGRQFYPGAQLARHTAQVLRHGQQTVETYARPNGSPRLLA
FT                   QIVRRGPRMGLHTHSERLLLTHGAMEALQLALRAVTQPGDAVGIEAPSYFNLYPLLANL
FT                   GLQAIELPTHPQHGLDVDALEAMLEHTSLAALVVMPTVHNPLGCTMPTPAKQRLAELVN
FT                   ARQLPLIEDAVYAELQFCEPPAPLLKAFDRDGWVMVVGGFSKTLAPDYRIGWLDGGRFA
FT                   ERIALLKFQSTGGEPQLLGDAVAAYLEAGSYEHHLHRMRRLYREQVGRLRQLVAEHFPA
FT                   GTRATEPQGGFLLWLELPGVDTRELFERALVEDIVFMPGQVYSRGARYRHCLRLSCCQT
FT                   LDARFIGAVERLGAIAKELASR"
     atggatacag atgaccagag cgcgatgatc ccaccccgct accaacggct gtccgatgaa        60
     ctggccgaag ccatccacgg cggacgtctc ccggtcggca gccgcctgcc ctcgctgcgg       120
     cagatggcgt cgcagcgccg gctcagcctg aacacggtga tcgccgccta tcgccagctg       180
     gaagatgccg gcctggtgat tccgcggccg aaggccggct tcgaagttgc gccgcgactg       240
     tcggtgccgc agcgttcgct gcgtgatacc ccatcagcgc cgaccgcgcc gctgcagcag       300
     gtgctgatgg cccgcgtgct ggaggcacaa cgccgcgccg gtgtgatcga tctggctttc       360
     gcgggaccgc gcggacgcca gttctatccc ggtgcgcagc tggcccggca taccgcacag       420
     gtactgcgcc acggccagca gacagtggaa acctacgcgc gcccgaacgg ctcgccgcga       480
     ctgctggcgc agatcgtgcg gcgcggtcca cgtatgggcc tgcacaccca cagcgagcgg       540
     ctgctgctga cccacggcgc gatggaagcc ctgcagctgg ccttgcgtgc agtaacccag       600
     cccggcgacg cggtaggcat cgaggcgccg tcctacttca acctgtaccc gttgctggcc       660
     aacctcggcc tgcaggccat cgagctgccc acccacccgc agcacggcct ggatgtcgat       720
     gcactggaag cgatgctgga gcacacgtcg ctggccgcgc tggtggtgat gccgaccgtg       780
     cacaacccgc tcggctgcac catgccgaca cccgccaaac aacgcctggc cgaactggtc       840
     aacgcgcgcc agctgccgct gatcgaagat gcggtgtacg cagaactgca gttctgcgag       900
     ccgccggcac cactgctgaa ggccttcgat cgcgatggct gggtgatggt ggtcggtggt       960
     ttctccaaga cgctggcgcc ggactatcgc attggttggc tggacggggg gcgcttcgcc      1020
     gagcgcatcg cgctgctcaa gttccagtcc accggtggcg aaccgcagct gctgggcgat      1080
     gcggtggcgg cctatctgga agcaggcagc tacgagcatc atctgcatcg catgcgccgc      1140
     ttgtaccgcg aacaggtcgg tcgcctgcgc cagctggtgg ccgaacactt tccggccggc      1200
     acccgtgcca ccgagccaca gggtggcttc ctgctgtggc tggaactgcc gggggtggat      1260
     acccgcgaac tgttcgaacg tgcgctggta gaggacatcg tgttcatgcc cggccaggtg      1320
     tattcgcgtg gcgcgcgcta ccgtcactgc ctgcggctgt cgtgctgcca gacgctggat      1380
     gcgcgcttca tcggcgcggt ggagcggctc ggtgcgatcg cgaaggagct ggcatcgcgc      1440
     tga                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page