(data stored in ACNUC7421 zone)

EMBL: CP001111.PE468

CP001111.PE468       Location/Qualifiers
FT   CDS_pept        complement(547361..549130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0468"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; cytochrome c biogenesis protein
FT                   transmembrane region; Redoxin domain protein; KEGG:
FT                   rme:Rmet_1170 cytochrome c biogenesis protein,
FT                   transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50173"
FT                   /db_xref="GOA:B4SIG8"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041017"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG8"
FT                   /protein_id="ACF50173.1"
FT                   /translation="MLLLLLAYLGGALTLLSPCILPVLPFVFARADRPFLRSTLPLLLG
FT                   MALTFTVVASLAAVGSQWVAQANQVGRWIALLLMALFAVALLWPRLADHLLAPFQRVGA
FT                   RLSARADAADAAGRGGAWTSLLIGVATGLLWAPCAGPILGLVLTGAALHGASVGTSSLL
FT                   LAYALGAITALALAVWVGGRVFRALQARLGLGDVLRKVLGVAALLAVVAIGLGWDTGLL
FT                   TRLSTVSTARIEQNLLDAVPGAQPAAPPMMMMAGANAGADAPLPVEGTLPALDGATGWL
FT                   NSPPLSAQQLRGKVVLVDFWTYSCINCLRAMPFVHEWERRYRDHGLVVIGVHTPEFAFE
FT                   RNPSNVMKAVQELKVEYPVALDNQYTIWRAFNNRYWPAQYFVDAQGNIRGHQFGEGNYA
FT                   RSEQVIRRLLTEAGQTNLPPPADPAAADLKGVAVQADMSNLRSPETYLGHARAEQFASP
FT                   GGQRSDSPFDYTLPTTLALNQWGLSGRWTVTDEAAQLQQAGGRIAFQFHARDLHLVLAP
FT                   SQDGTPVRFRVWLDGKPLTAADAGSDVGADGSGVVNEHRLYQLVRQRGTVGPHRFEIEF
FT                   LDTGVQAYAFTFG"
     atgctgctgt tgctgcttgc ctacctcggg ggcgcgctga ccctgctcag cccctgcatc        60
     ctgccggtgc tgccgttcgt gttcgcgcgt gccgaccgtc cattcctgcg cagcacgctg       120
     ccgttgctgc tgggcatggc gctcaccttc accgtggtcg ccagcctggc cgccgtaggc       180
     agccaatggg tggcgcaggc caaccaggtc gggcgctgga ttgccctgct gctgatggcg       240
     ctgttcgcgg tcgccctgtt gtggccacgg ctggccgacc atctgctggc gccgttccag       300
     cgtgtgggtg cacgcttgag cgcacgcgcc gatgccgcgg acgccgcagg acgtggcggc       360
     gcgtggacct cgctgctgat cggcgtcgcc accggcctgc tgtgggcgcc gtgcgccggt       420
     ccaatcctcg gcctggtgct gaccggtgct gccctgcatg gcgccagcgt cggtaccagc       480
     agcctgctgc ttgcctatgc attgggtgcg atcaccgcgc tggcgctggc ggtgtgggtc       540
     ggcggccgcg tgttccgtgc gctgcaggcg cggctcggcc tgggtgacgt actgcgcaag       600
     gtgctgggcg tagccgcact gctggccgtg gtggcgatcg gcctgggctg ggacactggc       660
     ctgctgaccc gtctttcaac ggtcagcacc gcgcgtatcg agcaaaacct gctggacgca       720
     gtacccggcg cgcagccggc ggcaccgccg atgatgatga tggccggcgc caatgcaggt       780
     gccgatgctc cgctgccggt ggaaggcacc ctgcccgcgc tggatggcgc caccggctgg       840
     ctcaacagcc cgccgctgag tgcacagcag ctgcgtggca aggtggtgct ggtcgacttc       900
     tggacctact cctgcatcaa ctgcctgcgc gcgatgccgt tcgtgcacga atgggaacgt       960
     cgctaccgtg accatgggct ggtggtgatc ggcgtgcaca cgccggagtt cgccttcgaa      1020
     cgcaacccga gcaacgtgat gaaggcggtg caggaactga aggtcgagta cccggtggcg      1080
     ctcgacaacc agtacacgat ctggcgcgcg ttcaacaacc gctactggcc ggcgcagtac      1140
     ttcgtcgatg cacagggcaa catccgcggc caccagttcg gcgagggcaa ctatgcacgc      1200
     tcggaacaag tgatccgccg gcttctgacc gaagccgggc agaccaacct gccaccaccg      1260
     gccgaccccg ccgccgccga cctgaagggt gtggccgtgc aggccgacat gagcaacctg      1320
     cgctcgccgg agacctatct gggccacgcg cgtgccgagc agttcgcctc acccggcggc      1380
     caacgcagcg atagcccgtt cgactacacg ctgccaacca ccctggcact gaaccagtgg      1440
     ggcctgtccg gacgctggac cgtcaccgac gaagccgcac agctgcagca ggccggtggc      1500
     cgcatcgcct tccagttcca cgcgcgggac ctgcacctgg tgctggcacc gagccaggac      1560
     ggcacgccgg tacggttccg cgtctggctg gacggcaagc cgctgaccgc tgccgatgcc      1620
     ggcagcgatg tcggtgccga tggcagcggc gtggtcaatg aacaccgctt gtaccagctg      1680
     gtacgtcagc gtggcacggt cggcccgcat cgcttcgaga tcgaattcct cgacacgggc      1740
     gtgcaggcct acgccttcac cttcggttga                                       1770
//

If you have problems or comments...

PBIL Back to PBIL home page