(data stored in ACNUC7421 zone)

EMBL: CP001111.PE471

CP001111.PE471       Location/Qualifiers
FT   CDS_pept        550566..552035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0471"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bac:BamMC406_5549 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50176"
FT                   /db_xref="GOA:B4SIH1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH1"
FT                   /protein_id="ACF50176.1"
FT                   /translation="MIKPNLWQKLAAVIAALMLMCCMALLALQMRANTRHEQEVVQRLS
FT                   LGLAEHIAQRSELMDTSGMRDAAVRALFGQLMAVNPSVEVYLLDDQGRILGHDAPSGHL
FT                   VRNKVDVAPLRRLLSGAPLPILGDDPRSADGRKVFSAAPLIVQGRQAGYVYVVLVGEHR
FT                   QMLADDLAAGSQWNTTWWSVMLVGSLGLLAGLVAFYWVTRPLRRLTRRIQAFDIDAPTP
FT                   LPPPEPLRPGERDELVILEHAHAQMAQRLGEQWQQLRQQDLQRRELVANISHDLRTPLS
FT                   SLHGYLETLALKDVTLSPDERRRYLGIALAQSAKVGRLARALFELARLEHGEVRLEWEV
FT                   FALPELLQDVLQKFELAAQARNQRLHAEFPPGLPLVRADLGLVERVLTNLLDNALRHAP
FT                   EGGRIEVCLRATADSIEVSVADDGPGVAAALRAQLFQAPAALGARRGENGGLGLLIVQR
FT                   IVQLHGRRIELRDSERGALFVFALPRAEPAA"
     atgatcaagc ccaatctgtg gcagaagctg gcggcggtga tcgccgcgct gatgctgatg        60
     tgctgcatgg cgctgctggc actgcagatg cgcgccaaca cccgccatga gcaggaagtg       120
     gtgcagcggc tgtcgctggg cctggccgaa cacatcgccc aacgcagcga actgatggac       180
     accagcggca tgcgcgatgc tgcggtgcgt gcgctgttcg gccagctgat ggcggtcaat       240
     cccagcgtcg aggtctacct gctggacgac cagggccgca ttctcggcca cgacgcgccc       300
     agcggtcatc tggtgcgcaa caaggtggac gtggcaccgc tacgccgcct gctgtcgggt       360
     gcgccactgc cgatcctcgg cgatgacccg cgcagcgccg atggccgcaa ggtgttcagt       420
     gccgcaccgt tgatcgtgca ggggcgccag gccggttacg tgtacgtggt gctggtcggt       480
     gaacaccggc agatgctggc cgacgacctg gcggcgggca gccagtggaa caccacatgg       540
     tggtcggtga tgctggtcgg aagcctcggc ctgctggccg ggctggtggc gttctactgg       600
     gtgacccgtc cgctgcggcg gctgacccgg cgcatccagg ccttcgatat cgatgcgccg       660
     acaccgttgc cgccgcccga accgctgcgc ccgggcgagc gcgacgagct ggtgattctc       720
     gaacatgcac atgcgcagat ggcgcagcgg ctgggtgagc agtggcagca actgcgccag       780
     caggacctgc agcggcgcga gctggtcgcc aacatctcgc acgacctgcg tacgccgttg       840
     tcgtcgctgc atggctatct ggaaacgctg gcgctgaagg acgtcacgct gtcaccggac       900
     gagcgccgcc gctacctcgg tatcgcgctg gcacagagcg ccaaggttgg ccggctggcg       960
     cgcgcgctgt tcgagctggc gcggctggag cacggtgaag tgcgtctgga gtgggaagtg      1020
     ttcgcgctgc cggaactgct gcaggacgta ctgcagaagt tcgagctggc cgcgcaggcg      1080
     cgcaaccagc gcctgcacgc cgagttcccg ccgggcctgc cgctggtacg tgccgacctg      1140
     ggcctggtcg agcgggtgct gaccaacctg ctcgacaatg cattgcggca cgcgccggaa      1200
     ggtgggcgga tcgaagtgtg cctgcgtgcg accgcggaca gcatcgaggt gagcgtggcc      1260
     gatgatggtc ccggcgtggc agcggcgctg cgcgcacagt tgttccaggc gccggccgca      1320
     ctgggcgcac ggcgtggcga gaacggtggc ctcggcctgt tgatcgtgca gcgtatcgtg      1380
     cagctgcatg gccgccgcat cgaactgcgc gacagtgagc gtggcgcgct gttcgtgttt      1440
     gccttgccgc gcgcggagcc ggcggcctag                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page