(data stored in ACNUC7421 zone)

EMBL: CP001111.PE472

CP001111.PE472       Location/Qualifiers
FT   CDS_pept        complement(552032..553378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0472"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: cvi:CV_0760 probable
FT                   two-component sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50177"
FT                   /db_xref="GOA:B4SIH2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH2"
FT                   /protein_id="ACF50177.1"
FT                   /translation="MKRTPSAMRGHAFHFLRYGIGFLVAHLLLIVLGLWAWDALLEDRT
FT                   EASLLAEMRGTHALLQQRFAETPRDQWPALARGLDADFAYALRMVPLAEAEKALSASQR
FT                   PPFNNGRVQIDLEHMRSLQRIGDSGYAVMLGPLDEALPEEGWQDSEVSGVAILLLILMV
FT                   AVALPMYVMVYRLWRDVSQLAQAARQMRDGQLDTRAPRAGTALVRPLANAFNHMAEQLQ
FT                   QLLESQRVLAQAVAHEVRTPLARMRFGLADLEDTALDEIQRDALGGLRTDVDRLQHLTD
FT                   AGVEYAALGRCHQLTRQRLQLAALVRGVVAQFAPLPMPVQQVLSPTGLVNVNRHMLELA
FT                   LRNLLGNALRYARRQIRIASTVNDGWLCLQVEDDGPGIAPELRGQVLQPYVRLDPGSPG
FT                   FGLGLALVQVVADKHGGHVEVTDSELGGACIRLHLPLESGGAVESEAAC"
     atgaagcgta cgccctcggc gatgcgcggc cacgccttcc acttcctgcg ctatggcatc        60
     ggcttcctgg tcgcccacct gctgctgatc gtgctgggcc tgtgggcctg ggatgcgctg       120
     ctggaagacc gcaccgaagc cagcctgctg gccgagatgc gtggcaccca tgcgctgctg       180
     cagcaacgct tcgcggaaac accacgcgac cagtggccgg cgctggcacg agggctcgac       240
     gccgacttcg cctatgccct gcggatggtg ccgctggccg aggcagagaa ggcgctgtcg       300
     gccagccagc gaccgccgtt caacaacggc cgagtgcaga tcgacctgga acacatgcgc       360
     agcctgcagc ggatcggcga cagcggctat gccgtgatgc tggggccact ggatgaggcg       420
     ttgcctgagg aaggctggca ggacagcgaa gtgtccggcg tggcgatcct gctgctgatc       480
     ctgatggtgg ccgtggcgct gccgatgtat gtaatggtct accgcctgtg gcgcgatgtg       540
     tcgcagctgg cacaggcggc gcggcagatg cgcgacggcc agctggatac gcgcgcgccg       600
     cgtgccggca ccgcgctggt gcggccgttg gccaatgcct tcaaccacat ggcagagcag       660
     ctgcagcaac tgctggagag ccagcgcgtg ctggcacagg cggtcgcgca tgaagtgcgc       720
     acgccgttgg cgcggatgcg cttcggcctg gccgacctgg aggacaccgc actcgacgag       780
     atccagcgcg atgcgctggg tggcctgcgt accgacgtcg atcgcctgca gcacctcacc       840
     gatgccggcg tcgagtacgc cgcgctgggc cgttgccatc agctgacccg ccagcgcctg       900
     cagctggccg cgctggtgcg cggcgttgtg gcccagttcg caccgctgcc gatgccagtg       960
     cagcaggtgc tgtcgcccac cggcctggtc aacgtcaacc ggcatatgct ggaactggcg      1020
     ctgcgcaatc tgctcggcaa tgccttgcgc tatgcgcggc ggcagatccg catcgccagc      1080
     acggtcaacg atggctggct gtgcctgcag gtggaggacg acggccccgg catcgcgccc      1140
     gaactgcgcg gccaggtgct gcaaccctat gtgcggctgg acccgggcag ccccggtttc      1200
     ggtctcggcc tggcactggt gcaggtggtg gccgacaagc atggcggcca cgtcgaggta      1260
     accgattcag agctgggcgg tgcctgcatc cgcctgcacc tgccgctgga aagcggcggt      1320
     gccgtggaga gcgaggcggc ctgctag                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page