(data stored in ACNUC7421 zone)

EMBL: CP001111.PE475

CP001111.PE475       Location/Qualifiers
FT   CDS_pept        complement(556763..557110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50180"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH5"
FT                   /protein_id="ACF50180.1"
FT                   /translation="MAAAFSDRFSDATRQLAAAATRANRLALENAESMFGVQLKVMERN
FT                   LTATGGWLGELARGEDAAGTLSKGAQLWQDNLQRLGQAQQDVVGLGLQASKAWSELVQG
FT                   YNQSTADASNH"
     atggccgccg ccttcagcga tcgcttcagt gatgccaccc gccagctcgc cgccgcggca        60
     acacgtgcga accggttggc gttggagaac gcggaaagca tgttcggcgt gcagctgaag       120
     gtgatggagc gcaacctgac cgcgaccggc ggctggctgg gtgaactggc ccgcggcgag       180
     gatgcggccg ggacgctctc caagggtgcg cagctgtggc aggacaacct gcagcggctg       240
     ggccaggccc agcaggacgt ggtcgggctt ggcctgcagg ccagcaaggc ctggtccgaa       300
     ctggtgcagg gctacaacca atcaacggcg gacgcgagca accactga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page