(data stored in ACNUC7421 zone)

EMBL: CP001111.PE478

CP001111.PE478       Location/Qualifiers
FT   CDS_pept        560495..563086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0478"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="SMART: peptidase M14 carboxypeptidase A; KEGG:
FT                   ilo:IL0695 secreted protein containing N-terminal
FT                   zinc-dependent carboxypeptidase related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50183"
FT                   /db_xref="GOA:B4SIH8"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033848"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH8"
FT                   /protein_id="ACF50183.1"
FT                   /translation="MSLHRRAVLPLLIAAAALFLPHPVQAQSAYFFPQIADPAAFDTAV
FT                   PTPEQFLGYPIGSRYTRHDQLVAYFQELAKRSDRISVREIGRSYEGRPLLIATVTAAGN
FT                   HARLEQIRQQHATLADPAQPRSAAGDSPVVVWLGYSVHGNETSSAEAAMLTAYYLVASR
FT                   SAETQQWLQQAVVLFDPAQNPDGRDRAANWHNAWASDPASADPADKEHVEPFPQGRTNH
FT                   YFTDLNRDWLALTQQDSRPKVEVFHQWYPNVQIDFHEMGKDSTYYFEPSPKSMHSPLIP
FT                   PASYEFNKTLAKYHAQALDALGSLYYTGENFDNFSPVYGSTYPDFHGAVGVTVEQASSR
FT                   GRVQESVNGLLTFPFTIRNQVATGLGTVRGAVSERSGLFDLQKQFFQSALKQAAQQPVK
FT                   SFVFGDAHDPALTRRLLELLLLHRIEVRALDRAVSVDGQHFEAGSAYVVPVQQAQFRLV
FT                   HSIFAETPPIKGDVFYGSTSYAIAPAYGVAFAGSRSRIEGGARVTAVPAAQGAVLGGQA
FT                   GFAYAIDWRDYNAGRALAALQDKGLSARAAFQPFTTATAQGEVNFAAGSLVIPVAGQPL
FT                   QGAALLEAVTAAARDAGVQVHSLASGRSREGIDLGSDGVKALRKPAVALVMGEGVAATE
FT                   IGSAWFLLDQQLHLPASKLDPQQLGKVPLDRYTTIVLSGGTYTGVDATAVAALKRWVQA
FT                   GGSLVTYGSASKWAIEQKLADGEKPGKDEDAADESRRAFGDQRDIAAIERVSGNILSAD
FT                   VDTSHPLAFGVPRRQLAINKENTVTLQPSANPFSTVVRIDATPRVNGYLSERNRARVAG
FT                   SAWLLVSAQGQGNVVLFADDPAHRKYWHGTDRLLINAIFFGNLVNPAKARG"
     gtgtccttgc atcgccgtgc cgttcttccg ttgctgatcg ccgccgccgc actgttcctg        60
     ccgcatccgg tgcaggcaca gagcgcttac ttctttccgc agattgccga cccagcggcg       120
     ttcgatacgg ccgtgcccac gccggagcag ttcctcggct atccgatcgg cagccgctac       180
     acccgacacg accagctggt ggcgtacttc caggaactgg cgaaacgctc ggacaggatc       240
     agcgtgcgcg agattggccg cagctatgag ggccgcccgc tgctgatcgc caccgtcacc       300
     gctgcaggca atcatgcgcg gctggaacag atccgccagc agcacgcgac cctggccgat       360
     ccggcgcagc cgcgcagtgc ggccggtgac agcccggtgg tggtgtggtt gggctacagc       420
     gtgcatggca acgaaacctc cagtgccgaa gcggcgatgt tgaccgccta ctacctggtg       480
     gccagtcgta gtgccgaaac ccagcagtgg ctgcagcagg cggtggtgct gttcgacccg       540
     gcgcagaacc cggatggccg tgatcgtgcg gccaactggc acaacgcgtg ggcctccgat       600
     ccagcctcgg ccgacccggc cgacaaggag cacgtcgagc cgttcccgca gggccgcacc       660
     aaccactact tcaccgacct caaccgcgac tggctggccc tgacccagca ggattcgcgg       720
     ccgaaggtgg aggtgttcca ccagtggtac ccgaacgtgc agatcgactt ccacgagatg       780
     ggcaaggaca gtacctatta cttcgagccc tcgccgaaga gcatgcatag tccgttgatt       840
     ccgccggcgt cgtacgagtt caacaagacc ctggccaagt accacgcgca agccttggat       900
     gcattggggt cgctgtacta caccggcgag aatttcgaca acttctcgcc ggtctacggc       960
     tccacctatc cggacttcca tggtgcagtg ggcgtcaccg ttgaacaggc cagctcacgc      1020
     ggccgcgtgc aggaatcagt gaacggcctg ttgaccttcc cgttcaccat ccgcaatcag      1080
     gtcgctaccg gcctgggtac cgtgcgcggc gcagtgagcg agcgcagcgg gctgttcgac      1140
     ctgcagaaac agttcttcca gagcgcgctg aagcaggccg cgcagcagcc ggtgaagagc      1200
     ttcgtgttcg gcgatgcgca tgacccggca ttgacccggc gcctgctgga actgttgctg      1260
     ctgcatcgca tcgaggtgcg cgcgctggat cgtgcagtca gtgtcgatgg gcagcacttc      1320
     gaagcgggca gcgcctacgt ggtgccggtg cagcaggcgc agttccgcct ggtgcattcg      1380
     atcttcgccg agacgccgcc gatcaagggc gatgtgttct acggcagcac cagctatgcg      1440
     atcgcaccgg cgtatggcgt ggcattcgcg gggagccgca gccgtatcga aggcggcgca      1500
     cgcgtgactg cggtgccggc agcgcagggc gcggtgctgg gtggccaggc cggcttcgcc      1560
     tatgccatcg actggcgcga ctacaacgcc gggcgcgcgt tggccgcgct gcaggacaag      1620
     ggattgagcg cgcgtgcggc gttccagccg ttcaccactg cgactgcaca gggcgaggtc      1680
     aacttcgctg ccggcagcct ggtgattccg gtcgccggtc aaccgttgca gggtgcggcg      1740
     ttgcttgagg cggtgaccgc cgcagcacgc gacgctggcg tgcaggtgca ctcgctggcg      1800
     agcggccgca gccgcgaggg catcgacctt ggcagtgacg gtgtcaaggc gctgcgcaag      1860
     cccgccgtcg cgctggtgat gggcgagggc gtggccgcca ccgaaatcgg ttcggcttgg      1920
     ttcctgctcg atcagcagct gcacctgccg gccagcaagc tggacccgca gcagctgggc      1980
     aaggtgccgc tggaccgcta caccaccatc gtgctgtcgg gcggcactta caccggcgtc      2040
     gatgccacgg cagtggccgc actgaagcgc tgggtgcagg ccggtggttc gctggtgacc      2100
     tacggtagtg cctcgaagtg ggcgatcgaa cagaagttgg ccgacggcga gaaacctggc      2160
     aaggacgaag acgctgctga cgagagccgc cgcgcgttcg gcgaccagcg tgacattgct      2220
     gcgatcgagc gcgtcagcgg caacatcctc agcgctgatg tggataccag ccatccgctg      2280
     gccttcggcg tgccgcgccg gcagctggcg atcaacaagg aaaacacggt gacgctgcag      2340
     ccgagcgcga acccgttctc cacggtggtg cgcatcgatg ccacgccgcg ggtgaacggc      2400
     tatctgtccg agcgcaaccg cgcgcgggtg gccggcagtg cgtggctgct ggtttcggcg      2460
     caggggcagg gcaacgtggt gttgtttgcg gatgatccgg cgcaccgcaa gtactggcac      2520
     gggacggacc ggctgctgat caacgcgatc ttcttcggga atctggtgaa tccggctaag      2580
     gcgcggggtt ga                                                          2592
//

If you have problems or comments...

PBIL Back to PBIL home page