(data stored in ACNUC7421 zone)

EMBL: CP001111.PE479

CP001111.PE479       Location/Qualifiers
FT   CDS_pept        complement(563262..564176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0479"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: amr:AM1_6037
FT                   transposase, IS116/IS110/IS902 family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50184"
FT                   /db_xref="GOA:B4SIH9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH9"
FT                   /protein_id="ACF50184.1"
FT                   /translation="MNGIGIDVSKRQLDIGTTDGETLQVSNNRSGFSELDVWLKKRPTS
FT                   QIVLEATGGYEQPVLDLLHKVGHPVARANALRARKLAQGLGQIAKTDRLDAYALAQMAA
FT                   LVKLPPYQPLQPWQQKMREFVRARRQAMDALTIARQQQEMVLDRELRRLLQGNITRLQT
FT                   MVERLGKQIAEQVGQQPQLKTLKSMKGVGPALQAVLASYLPELGRITGKRIASLVGVAP
FT                   MSHDSGTMRGKRSIHGGRAEIRQVLYMAAMSAMRHEPRLRDFYQSLRARGKEGKVAIVA
FT                   VMRKMLVILNARVRDAESGLVPA"
     atgaacggga tcgggattga tgtcagtaag cgccagctgg atatcggtac gacggacgga        60
     gaaaccctgc aggtcagcaa caaccgctcc gggttttctg aattggatgt ttggctgaag       120
     aagcgtccga ccagccagat cgtgcttgaa gccacaggtg gctatgagca gccggtgctg       180
     gatttactgc acaaggtcgg tcatccggtg gcccgtgcca atgccttgcg cgcccggaaa       240
     ctggctcagg ggttgggtca gattgccaaa accgaccgtt tggatgccta cgcgttggcg       300
     cagatggccg ccctggtgaa gctacctccc tatcagccgc tgcagccttg gcagcagaag       360
     atgcgggagt tcgttcgggc acgtcggcag gcgatggacg ccttgaccat cgcgcggcag       420
     cagcaggaaa tggtgcttga tcgtgaactg cgccgactac tgcagggcaa catcacccgc       480
     ctacaaacga tggttgagcg tctgggcaag cagatcgccg agcaggttgg tcagcaacct       540
     caactgaaga cgctgaagtc aatgaagggc gtagggcctg cgctgcaggc agttctagcc       600
     agctatctgc cagagcttgg caggatcact ggcaagcgca tcgccagcct ggtcggggta       660
     gctccgatgt cccacgacag cggcacgatg agaggaaaac gaagcatcca cggtggaaga       720
     gccgaaatcc ggcaagtgct ctacatggcg gcaatgtcgg ccatgcggca tgaacctcgg       780
     ttacgcgact tttaccagtc gctacgagcc cgcggcaagg aaggcaaggt ggccatcgtg       840
     gcagtgatgc ggaagatgct ggtcatcctc aacgcccgtg tccgcgacgc tgaaagcgga       900
     ctagtccctg cctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page