(data stored in ACNUC7421 zone)

EMBL: CP001111.PE48

CP001111.PE48        Location/Qualifiers
FT   CDS_pept        complement(55891..56619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0048"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_0326 Sel1 domain protein
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49753"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRN3"
FT                   /protein_id="ACF49753.1"
FT                   /translation="MKAKHAPLCLLLGLSMAAAVTARECPVEAPRQIPPTVLTGGFFDA
FT                   HPDLFWRSMAQRAERDKRPARALDYYKRSARYADKFSQAMVARLYQEGIGTRADPVMAY
FT                   IWMDLAAERMYHDFLVLREHYWARLDALQQAQAIERGQQVYADYGDRVAKPRMERALRD
FT                   GRQQITGSRLGYVSSGLIVVQRRGNEQGIATPGSIVYDNDYWRAADYWCLQDNYWRPAL
FT                   TPSVEIGRPDTVRDDKAVGD"
     atgaaagcga agcacgctcc actctgcctg ctgctgggcc tgtcgatggc cgctgccgtg        60
     accgccaggg aatgtccggt ggaggccccg cggcagatcc cgccaaccgt cctgaccgga       120
     ggcttcttcg atgcccatcc ggacctgttc tggcgcagca tggcccagcg ggccgaacgg       180
     gacaaacggc ccgccagggc gctggactac tacaagcgtt cggcgcgcta cgccgacaag       240
     ttttcccagg ccatggtggc gcggctgtat caggagggca tcggcacccg ggccgatccg       300
     gtgatggcct acatctggat ggacctggcc gccgagcgca tgtatcacga cttcctggtg       360
     ctgcgggagc actattgggc acgcttggac gcactccagc aggcacaggc gatcgagcgc       420
     ggccagcagg tgtatgccga ctacggcgac cgcgtggcca agcctcgcat ggagcgcgcc       480
     ctcagggacg gtcgccagca gatcaccggc agccgccttg ggtacgtgag ctccggactg       540
     atcgtcgtcc agcgccgcgg caacgagcag ggcatcgcga ccccgggcag catcgtctac       600
     gacaacgact actggcgagc cgccgactac tggtgcctgc aggacaacta ctggcgcccc       660
     gcgctgacgc ccagcgtcga gataggacgg ccggacacgg tccgcgacga caaggcggtg       720
     ggcgactag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page