(data stored in ACNUC7421 zone)

EMBL: CP001111.PE480

CP001111.PE480       Location/Qualifiers
FT   CDS_pept        complement(564863..566278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0480"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   xcv:XCV3733 ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50185"
FT                   /db_xref="GOA:B4SII0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII0"
FT                   /protein_id="ACF50185.1"
FT                   /translation="MSFESLGLAPFLLRALAEQGYETPTPIQQQAIPLVLAGRDLLAGA
FT                   QTGTGKTAAFGLPLLQHLGTASQEVRTGPRKPRALILAPTRELATQVHDSLRGYSKYLR
FT                   IPSACIYGGVGMGNQLDILRRGVDLLVACPGRLIDHLERRSIDLSGIELLVLDEADRML
FT                   DMGFLPSIKRILAKLPKQNRQTLLFSATFEDNIRQLALEFMRNPEQIQVTPKNTVAETI
FT                   THRVHPVDGGRKRDLLLHLLAQDSREQTLVFARTKHGSDKLAAFLEKSGIKTAAIHGNK
FT                   SQGQRLRALGDFKAGRVTVLVATDIAARGIDINELPKVINFDLPMVAEDYVHRIGRTGR
FT                   NGATGQAISLVAQDEVKLLRAITRLLGRDMDIRDVPGFELQVPIRWGNSAPGKAEHETG
FT                   ERAPRKNHARRPHGDAPRHAHAGPKKAGGGRREGGGNGQQRAGAGAGQGQRRGGAGNGG
FT                   GRGRGQGGGGRAS"
     atgtcttttg aatccctggg ccttgcgccc ttcctgctgc gtgcgctcgc cgagcagggc        60
     tatgaaaccc cgaccccgat ccagcagcag gcgatcccgc tggtgctggc cggccgcgac       120
     ctgctggccg gcgcgcagac cggtaccggc aagaccgctg cctttggcct gccgctgctg       180
     cagcacttgg gcaccgcctc gcaggaagtg cgtaccggcc cgcgcaagcc gcgtgccctg       240
     atcctggccc cgacccgcga gctggccacc caggtgcatg acagcctgcg cggttacagc       300
     aagtacctgc gcatccccag cgcctgcatc tacggcggcg tcggcatggg caaccagctc       360
     gacatcctgc gccgtggcgt ggacctgctg gtggcctgcc cgggccgcct gatcgaccac       420
     ctggagcgtc gcagcatcga cctgtccggc attgaactgc tggtactgga cgaagccgac       480
     cgcatgctgg acatgggctt cctgccctcg atcaagcgca tcctggccaa gctgcccaag       540
     cagaaccgcc agaccctgct gttctcggcc accttcgagg acaacatccg ccagctggcg       600
     ctggaattca tgcgcaaccc ggagcagatc caggtcacgc cgaagaacac cgtcgctgaa       660
     accatcaccc atcgcgtgca cccggtcgat ggcggccgca agcgcgacct gctgctgcac       720
     ctgctggcgc aggacagccg cgagcagact ctggtgtttg cccgcaccaa gcacggcagc       780
     gacaagctgg ccgcgttcct ggaaaagtcc ggcatcaaga ccgcggcgat ccacggcaac       840
     aagagccagg gccagcgcct gcgtgcactg ggcgatttca aggccggccg ggtgaccgtg       900
     ctggtggcta ccgatatcgc tgcgcgcggt atcgacatca acgagctgcc gaaggtgatc       960
     aacttcgacc tgccgatggt ggccgaagac tacgtgcacc gcatcggccg taccggccgc      1020
     aacggcgcca ccggccaggc aatctcgctg gtcgcgcagg atgaagtgaa gctgctgcgt      1080
     gcgatcaccc gcctgctcgg ccgcgacatg gacatccgcg atgtgccggg cttcgagctg      1140
     caggtgccga tccgctgggg caacagtgca ccgggcaagg ccgagcacga aaccggtgag      1200
     cgcgcaccgc gcaagaacca cgcgcgccgt ccgcacggcg atgcaccgcg tcacgcgcat      1260
     gccggcccga agaaggctgg cggtggtcgt cgtgagggcg gtggcaatgg ccagcagcgt      1320
     gccggtgcag gcgccggtca gggccagcgt cgtggcggtg ctggcaatgg tggtggccgt      1380
     ggccgcggcc agggtggcgg cggtcgcgcc agctga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page