(data stored in ACNUC7421 zone)

EMBL: CP001111.PE482

CP001111.PE482       Location/Qualifiers
FT   CDS_pept        568178..568846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0482"
FT                   /product="maleylacetoacetate isomerase"
FT                   /note="TIGRFAM: maleylacetoacetate isomerase; PFAM:
FT                   Glutathione S-transferase domain; KEGG: xcv:XCV3731
FT                   maleylacetoacetate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50187"
FT                   /db_xref="GOA:B4SII2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII2"
FT                   /protein_id="ACF50187.1"
FT                   /translation="MEIPVDDGIALYTYWRSSAAYRVRIGLELKGLAWEARPVHLVREG
FT                   GEQHLDAYRALNPQQLVPTLLHEGQALTQSLAILEYLDERFPQVPLLPADAAGRARVRA
FT                   LAQLVACDIHPINNLRVMQYLERSLQVPADARTQWTLHWIAEGFTAMEAMLANSSATGT
FT                   FCHGDRPGLADICLLPQLYNAHRFGLDLTPYPTLRRIEAACQALDAFDRARPENQLDAA
FT                   "
     atggagatcc cggtcgacga cggcatcgcg ctgtatacct actggcgatc cagcgccgcc        60
     taccgcgtgc gcatcggcct ggagctgaag ggcctggcct gggaggcccg gccggtgcac       120
     ctggtgcgcg aaggcggcga gcagcatctc gacgcctatc gcgcgctcaa tccgcagcag       180
     ctggtgccga ctctgctgca tgaagggcag gcgctgaccc agtcgctggc gatcctggag       240
     tacctggatg agcgcttccc gcaggtgccg ctgctgccgg ccgatgctgc cggtcgtgcg       300
     cgggtgcgag cattggccca gctggtggcc tgcgacatcc acccgatcaa caacctgcgg       360
     gtgatgcagt acctggagcg cagcctgcag gtgccggccg atgcccgcac gcagtggacc       420
     ctgcactgga tcgccgaggg tttcactgcg atggaagcga tgctggccaa cagcagcgcg       480
     acgggcacct tctgccacgg tgaccgtccc ggcctggccg acatctgcct gctgccgcag       540
     ctgtacaacg cgcaccgctt cggcctggac ctcacgccgt acccgacctt gcgccgcatc       600
     gaagcggcat gccaggcact ggacgccttc gaccgcgcac gcccggaaaa tcagctcgac       660
     gccgcctga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page