(data stored in ACNUC7421 zone)

EMBL: CP001111.PE483

CP001111.PE483       Location/Qualifiers
FT   CDS_pept        complement(568924..570051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0483"
FT                   /product="twitching motility protein"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; KEGG: xcv:XCV3730 Tfp pilus
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50188"
FT                   /db_xref="GOA:B4SII3"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII3"
FT                   /protein_id="ACF50188.1"
FT                   /translation="MDIGYFLKLMTEKNASDMFLTTGAPVYIKIEGKLYPLGNTGLPPG
FT                   MVKKIAYSLMDEGQVPQFERELELNMAIALPDAGRFRVNVFKQRGEVGMVIRAIRSRIP
FT                   SIEELNLPQVLKDVIMTPRGLVLVVGSTGSGKSTSLASMIDHRNSTTTGHILTIEDPIE
FT                   YLHKHKMSIVNQREVGLDTHAFHNALKNAMREAPDVILIGEILDAETMEAAIAFAETGH
FT                   LCLATLHSNNADQTIERILNFFPESAHKNVLMNLALNLRAVVSQRLVKNKEGRRLPATE
FT                   VLINTPMIRDLLRRGQVHEIKAAMEGSLEEGMESFDQCLFRLAKAGTIEQEEALRAADS
FT                   RDGLALKFRLSEGSSGEHDPYADFSAGAPSITHGF"
     atggatatcg gctacttcct gaagctgatg accgaaaaga acgcttcgga catgtttctg        60
     accaccgggg caccggtcta catcaagatc gaggggaagc tctatccgct gggcaatact       120
     ggcctgccgc cgggcatggt caagaagatc gcctactcgc tgatggacga aggccaggtg       180
     ccgcagttcg agcgcgagct ggagctgaac atggccatcg ccctgcctga tgcggggcgc       240
     ttccgggtca atgtattcaa gcagcgcggc gaagtcggca tggtcattcg cgccatccgc       300
     agccgcatcc cgagcattga agagctgaac ctgccgcagg tgctgaagga cgtcatcatg       360
     accccgcgcg ggctggtgct ggtggtgggg tccaccggtt ccggcaaatc cacctcgctg       420
     gcgtcgatga tcgaccaccg caacagcact accaccggcc acatcctcac catcgaggac       480
     ccgatcgagt acctgcacaa gcacaagatg tcgatcgtca accagcgcga ggtcgggctg       540
     gacacccatg ccttccacaa cgcgctgaag aatgcgatgc gcgaggcgcc ggacgtgatc       600
     ctgatcggcg agatcctgga cgcggaaacg atggaggcgg cgatcgcctt cgctgagacc       660
     ggtcacctgt gcctggccac cctgcactcc aacaatgccg accagaccat cgagcgcatc       720
     ctcaacttct tcccggaaag cgcgcacaag aacgtgctga tgaacctcgc gctgaacctg       780
     cgcgcggtgg tcagccagcg cctggtgaag aacaaggaag gccgccggct gccggccaca       840
     gaggtcctga tcaatacgcc gatgatccgc gacctgctgc gccgcggcca ggtgcacgag       900
     atcaaggccg cgatggaagg ctcgctggaa gaaggcatgg agagcttcga ccagtgcctg       960
     ttccggttgg ccaaggccgg caccatcgag caggaggaag cattgcgcgc ggccgactca      1020
     cgcgatggcc tggccctgaa gttccgcctg tccgaaggca gcagcggcga gcacgacccg      1080
     tacgccgact tctcggccgg tgcgcccagc atcacccacg gattctga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page