(data stored in ACNUC7421 zone)

EMBL: CP001111.PE484

CP001111.PE484       Location/Qualifiers
FT   CDS_pept        570173..570538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0484"
FT                   /product="outer membran protein"
FT                   /note="KEGG: xac:XAC3606 outer membran protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50189"
FT                   /db_xref="InterPro:IPR025511"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII4"
FT                   /protein_id="ACF50189.1"
FT                   /translation="MRHGLYVMAFAFALSAPVWAQDAALELAQARQAVDKATQADADQY
FT                   APDLIGLARQGLEQAQRAAGDRRERKNAPAMALRAAADADLARVRSEEATVTAQLQLRR
FT                   NEVNQLQRQLSTGEDRR"
     atgcgccatg gcctgtatgt gatggcgttt gcattcgcac tgtctgcccc cgtttgggcg        60
     caggacgccg cactggaact ggcgcaggcc cggcaggcgg tcgacaaggc cacccaggcc       120
     gatgccgacc agtacgctcc ggatctgatc gggctggccc ggcaggggct ggagcaggcc       180
     cagcgcgccg ccggcgaccg ccgcgagcgc aagaacgccc cggcgatggc cctgcgcgcc       240
     gccgccgatg ccgacctggc ccgcgtccgt agcgaggaag ccaccgtcac cgcgcagctg       300
     cagctgcgcc gcaacgaggt caaccagctg caacgccagc tgtcgaccgg ggaggaccgc       360
     cggtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page