(data stored in ACNUC7421 zone)

EMBL: CP001111.PE489

CP001111.PE489       Location/Qualifiers
FT   CDS_pept        573840..575012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0489"
FT                   /product="Cystathionine gamma-lyase"
FT                   /EC_number="4.4.1.1"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG: xcb:XC_3635
FT                   cystathionine gamma-lyase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50194"
FT                   /db_xref="GOA:B4SII9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B4SII9"
FT                   /protein_id="ACF50194.1"
FT                   /translation="MSNATSQDRALALATLAIHGGQSPDPSTGAVMPPIYATSTYAQSS
FT                   PGEHQGFEYSRTHNPTRFAYERCVASLEGGTRGFAFASGMAASSTVIELLDAGSHVVAM
FT                   DDIYGGSFRLFERVRRRTAGLDFSFVDLTDLAAFEASITPKTKMVWIETPTNPMLKIVD
FT                   IAAVAAIAKRHGLIVVVDNTFASPMLQRPLELGADLVLHSATKYLNGHSDMVGGMVVVG
FT                   DNAELAEQMAFLQNSVGGVQGPFDSFLALRGLKTLPLRMKAHCANALALAQWLEKHPAV
FT                   EKVIYPGLASHPQHELAGKQMAGYGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVE
FT                   SLVNHPAVMTHASIPVARREQLGISDALVRLSVGVEDLGDLQVDLGEALK"
     atgtccaacg ctacttccca ggatcgtgcc ctggccctgg ctaccctggc catccacggt        60
     ggccagtcgc cggaccccag taccggtgcg gtgatgccgc cgatctacgc tacctcgacc       120
     tatgcgcagt ccagcccggg tgagcaccag ggcttcgagt attcgcgtac ccacaacccg       180
     acgcgcttcg cctacgagcg ctgtgtggcc tcgctggaag gcggtacccg tggcttcgcc       240
     ttcgcttcgg gcatggccgc cagctcgacc gtgatcgagc tgctggacgc cggcagccat       300
     gtggtggcga tggatgacat ctatggcggc agcttccgcc tgttcgagcg tgtgcgtcgc       360
     cgtaccgccg ggctggactt cagcttcgtc gatctgaccg atctggcggc gtttgaagcc       420
     tccatcacgc cgaagacgaa gatggtctgg atcgagaccc cgaccaaccc gatgctgaag       480
     atcgtcgaca tcgctgcggt cgccgccatc gccaagcgcc atggcctgat cgtagtggtc       540
     gacaacacct tcgcctcgcc gatgctgcag cgtccgctgg agctgggcgc ggacctggtc       600
     ctgcattcgg ccaccaagta cctcaatggc cactcggaca tggtcggcgg catggtcgtg       660
     gtcggtgaca acgccgaact ggccgagcag atggccttcc tgcagaactc ggtgggtggc       720
     gtgcagggcc cgttcgacag cttcctggcc ctgcgtggcc tgaagaccct gccgctgcgc       780
     atgaaggcgc attgcgccaa cgcgctggcc ctggcccagt ggctggaaaa gcatccggcg       840
     gtggagaagg tgatctaccc gggcctggcc tcgcacccgc aacatgagct ggcgggcaag       900
     cagatggctg gctacggcgg catcgtttcg atcgtgctca agggcggttt cgatgcggcc       960
     aagcgcttct gcgagaagac cgaactgttc acccttgccg aatcgctggg cggcgtggaa      1020
     agcctggtca accacccggc ggtgatgacg catgcgtcga ttccggtggc gcgtcgtgag      1080
     cagctgggca tcagcgatgc gctggtgcgg ctgagtgtgg gtgttgagga tctgggggat      1140
     ctgcaggtgg atctgggaga ggctttgaag tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page