(data stored in ACNUC7421 zone)

EMBL: CP001111.PE492

CP001111.PE492       Location/Qualifiers
FT   CDS_pept        576600..578840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0492"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mxa:MXAN_4620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50197"
FT                   /db_xref="GOA:B4SIJ2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIJ2"
FT                   /protein_id="ACF50197.1"
FT                   /translation="MNTRNRDYWINRSGDLYADQQKVRREAGNSNYARQEAWLVGFLAE
FT                   RSEQLGRPVRVLDFGVGFGRLARLLPQHAFVDYFGFDISPAMVEPLLREPPAELAVDIG
FT                   RRIRVGSSLTEAMQGEQFDMIFTVSVLIHNNREQAADALAQMRALLAPEGRLCFIENRP
FT                   VSISLLANLWHAGCWSHDFAGTLAPDMNVDVEDGILSDHAIYILHEPAAGILRQLRVPG
FT                   AHGFEPITAGDYLLRTLEATTAVARGMEVESAALGDGIAQMRDAVELYRQAEEHARRNL
FT                   DIARQHLGDDVGLLDGVAHLTAAIDALPALAARIGVLGGETSAQHAQSSERIEALHARE
FT                   AALVESLTQQERELEQAQARLEAAQSANQHLQWQQGLREQVRQVLSSRTDEGAMPYLDA
FT                   PVGGSASVGQPAPSVYEFNARRDLRFAQTVVGHERVCHIMHQEWFGIRAACGSLPGHKL
FT                   AVTSTSAPGAGDVEEVARLLAANKVNRLVIHGFSDGMLQWVKGLAAAGFDRIYMVWHGA
FT                   PSMWIHAEERRLFALAYKAVRTGLIRRVSVMRAGSHAALADVAGWQRQLYNMPPAYTGK
FT                   RIPRRATGATVFIPSWNLIHKNIFTNAAAAAATGEVANIWLMADDFALPYRVDKNVKRL
FT                   PKLSQLQMMEAMSQADAVMNASIVDCHPMVELEALAAGTPALRGRLGMDALEDHPYVEI
FT                   TQVADPLSVADVRQTLRRMLAAPVVEMDDMMSSYSRQMVALSFERYSEFMEI"
     atgaatactc gtaaccggga ctactggatc aacaggagcg gtgatctcta tgccgaccag        60
     cagaaggtcc ggcgtgaggc aggcaacagc aattacgcca ggcaggaagc gtggctggtg       120
     ggattcctcg cggagcgttc cgaacaactg gggcggccgg tccgggtact ggatttcggg       180
     gtgggcttcg gacgccttgc gcggttgcta ccgcagcatg ccttcgtgga ctacttcggt       240
     ttcgatatct cccccgcgat ggtggagccg ctgctacgtg aaccgcctgc tgaactggcc       300
     gtagacatcg ggcgccgcat ccgcgtcgga tcttcattga ccgaggccat gcagggtgag       360
     cagtttgata tgatcttcac cgtctcggtg ttgatccaca acaaccgcga acaggcggca       420
     gacgcacttg cacagatgcg tgcgttgctg gcgcccgagg ggcggctgtg cttcatcgag       480
     aaccgaccgg tgtcgatcag cctgctggcc aacctgtggc atgcaggttg ctggagtcat       540
     gattttgccg gcacgttggc gcctgacatg aatgtggacg tcgaagacgg aatcctttcg       600
     gaccatgcca tctacattct gcatgaacct gccgcgggga tccttcgtca gcttcgtgtg       660
     ccgggcgccc acgggtttga accgatcacc gccggtgact acctgttgcg gacgctggag       720
     gctaccacgg ctgttgcgcg tggcatggaa gtggaaagtg ccgcgcttgg cgacggcatc       780
     gcgcagatgc gcgatgcggt ggaactctat cgtcaggccg aagagcacgc gcgaagaaat       840
     ctggacatcg cgcgacagca tcttggcgat gacgtgggcc tgttggatgg cgtcgcccat       900
     cttaccgcag ccatcgatgc gctcccggca ttggcggcgc gtatcggcgt gctggggggc       960
     gagacctctg cgcagcacgc ccagtcctcg gagcggatcg aagcgctgca tgcgcgtgaa      1020
     gcggcccttg tcgagtcgct gacgcagcag gagcgggagc ttgagcaggc gcaggcccgg      1080
     ttggaagctg cgcaaagcgc caaccagcac ctgcaatggc agcagggcct tcgtgaacag      1140
     gtccgccaag tcctgagcag ccggacggac gagggcgcca tgccatacct cgacgcgccg      1200
     gtcggtggca gtgcctcggt cggtcagccc gcaccctcgg tctacgaatt caacgcccgt      1260
     cgcgacctgc gtttcgcaca gactgtggtc gggcatgagc gggtatgcca catcatgcat      1320
     caggagtggt tcggtatccg cgcggcctgc ggctcgctgc cggggcacaa gcttgcggtg      1380
     accagtacct cagcgcccgg cgccggtgat gttgaggagg tggcccgtct gcttgccgcc      1440
     aacaaggtga atcggctggt tatccatgga ttctccgacg gcatgttgca gtgggtgaaa      1500
     ggtctcgctg cggctggatt cgaccggatc tacatggtct ggcatggtgc gccttcgatg      1560
     tggatccatg ctgaagagcg gcgcctgttc gccctggcct acaaggcggt ccgcaccggc      1620
     ctgatccgca gggtcagtgt catgcgcgca ggttcccatg cggcgcttgc agacgtagcg      1680
     ggctggcaga ggcagctcta caacatgccg ccagcctata ccggcaagcg cattccgcgg      1740
     cgggcgactg gtgccaccgt attcattccg tcctggaacc tgatccacaa gaacatcttc      1800
     acgaatgctg cggctgcggc tgcgaccggt gaagtggcaa acatctggct gatggcggat      1860
     gatttcgcat tgccgtaccg ggttgacaag aatgtcaagc gtcttccaaa actcagccaa      1920
     ttgcagatga tggaggcgat gtcgcaagcc gatgcagtga tgaatgcctc aatcgtcgat      1980
     tgccatccga tggtggagtt ggaggcgctt gctgcaggta ctcccgcgct gcggggacgt      2040
     ctggggatgg atgcgctgga agaccatccc tatgtcgaga ttacccaggt ggccgatcct      2100
     ctcagtgttg ccgacgtgcg ccagacgttg cgtcggatgc tggcggctcc cgtagtagag      2160
     atggatgaca tgatgtcgtc ctactcgcgc cagatggtgg cgttgtcctt cgagcgatac      2220
     tcagaattta tggaaatcta a                                                2241
//

If you have problems or comments...

PBIL Back to PBIL home page