(data stored in ACNUC7421 zone)

EMBL: CP001111.PE493

CP001111.PE493       Location/Qualifiers
FT   CDS_pept        578843..581014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0493"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mxa:MXAN_4619 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50198"
FT                   /db_xref="GOA:B4SIJ3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIJ3"
FT                   /protein_id="ACF50198.1"
FT                   /translation="MGLRVFVTRELFPFTAGGIGRVIANMLMTAPEEERAEMAVLYVGD
FT                   NVEADAFAVAHPVVTFLAWPHSRFQQVDERGEIFPPMPAFTHSMLHWESVHVLQGLLEL
FT                   ERLKGPLEYVEFVDWGAPAFAATQEKLLGSALTTATLAVRLHTTDSILADFEPRVQSVH
FT                   GLNLFDLERKALADCDLIVGQIAPVAEAFRVFYGFSEEEWTPRLRLHAPPVLLDTMQPV
FT                   AQTTVIDDTTSLLFTSKLQDIKRPDTFIRGCIQFLRDRPRYQGNIVFLAHSFDVSYQEY
FT                   VISLVPEDLRSRVVFARGVTGAAREKSISGAVCVFPSPWESFCLAAYEASLSGAACVLN
FT                   AQNPAFGPGSPWRDGCNCSTFDGSAEDLARALCGLFESTVGRLSPVEVPKDPLPWKGLD
FT                   PVAVPAAVPLDRQLTVVVVNRDSAGRVLNSLDSILASNLTLDKLIVIDDASRDPRDIAA
FT                   LDQLGNNDPRLSVHRLAVPVGDAVARNMGLALVETPFAGFVRGGDQLLPGFLNGAVSAL
FT                   ASQPDFDVVVGQVGVTVDPDDVIAGNVAPDGFRIFYGEGRLAGLYENRLAPESYVIRTE
FT                   VARRFAFDPVIPALEVWEMMLRACQSGARFMVTSAVNVLARHQGQPDERHLEQIQIAMR
FT                   RRLQRKRVRVGSLEVPAYFIFGAHVSPSGFMGDASNAEMAYRLQALMESESVRYTLALA
FT                   RLLQKRAPWVLRLGKWSVQRLAPIYRRLR"
     atgggcttga gggtttttgt tacccgcgaa cttttcccct ttaccgccgg tggcattgga        60
     cgcgtgatcg cgaacatgct gatgaccgcg ccggaagaag agcgcgcgga gatggcagta       120
     ctttacgttg gcgacaacgt cgaagcggat gcgttcgcgg tcgcccaccc ggtcgtgacc       180
     ttcctcgcgt ggccgcattc gcgctttcaa caagtagacg agcgtgggga gattttcccg       240
     ccaatgccgg cgttcaccca cagtatgctg cactgggaat cggtgcatgt gctgcagggg       300
     ctgctcgagc tggaacgtct gaaaggcccg cttgagtatg tcgagttcgt ggactggggg       360
     gcacctgcgt tcgccgcaac ccaggaaaag ctgcttggca gcgcattgac gacggccacg       420
     ctggccgtgc gcctgcacac cacagacagc attctggccg attttgagcc gcgcgtgcag       480
     agtgtgcacg ggttgaatct ctttgacctg gaacgaaagg cactggccga ttgcgacctt       540
     atcgtcggtc agatcgcgcc ggttgccgag gcgttccgcg tgttctacgg tttcagcgag       600
     gaggagtgga ctccacgcct gcgcctgcat gctccgccgg tgttgctgga tacgatgcag       660
     ccggtcgcgc agaccaccgt gatcgatgat acaacgtcgc tgttgttcac ttcgaaactg       720
     caggacatca agcgcccaga tactttcatc cgtggctgca tccagttcct gcgggacagg       780
     ccgcgttatc agggcaacat tgttttcctg gcgcattctt ttgatgtgag ctatcaggag       840
     tatgtcatct cgctggtgcc ggaggacctg cgcagccggg tggtgtttgc ccgtggcgta       900
     accggtgcgg cgcgcgagaa gagcatttct ggcgcggtat gcgtattccc gtcgccatgg       960
     gagtcgttct gccttgctgc gtacgaggcg tcgctgtcag gcgcagcctg cgtgctcaat      1020
     gcgcagaatc cggctttcgg gccgggcagt ccgtggcggg atggatgtaa ctgcagcacg      1080
     tttgatggca gcgccgaaga cctggcacgc gcgctttgcg ggctttttga aagcaccgtc      1140
     ggccgactgt cgccggtcga ggtgccgaag gacccgcttc cctggaaggg gcttgatccg      1200
     gtggcggtgc ctgctgccgt tcccctggac aggcaattga ccgtagtcgt cgtcaatcgc      1260
     gatagcgcgg gccgggtgtt gaattcgctg gacagcatcc tcgcgtccaa tctgacgctt      1320
     gacaagctga tcgtgattga cgatgcctcg cgcgacccgc gcgatatcgc tgcgctggac      1380
     cagctgggca acaatgatcc acgtttgtcc gtgcaccggc ttgcggtgcc cgttggtgac      1440
     gctgtagcgc gcaacatggg ccttgcgttg gttgagacgc cgtttgctgg attcgtgcgt      1500
     ggtggtgacc agttgctgcc gggcttcctc aatggcgcgg tgagcgcatt ggcgtcgcaa      1560
     ccggattttg atgtggtcgt ggggcaggtg ggcgtgaccg tagatcccga tgatgtgatc      1620
     gccggcaatg tcgccccgga tggattccgc attttctatg gtgaaggacg cctcgcagga      1680
     ctctacgaga accgcctggc gccggaaagc tacgtgatcc ggaccgaggt cgccaggcgc      1740
     ttcgcattcg atcccgtcat ccctgcactt gaagtatggg aaatgatgct gcgcgcctgc      1800
     cagtcgggtg cacgcttcat ggtgacttcc gccgtgaacg tgcttgcacg gcatcagggg      1860
     caaccagatg aacggcactt ggagcagatc cagatcgcga tgcgccgacg cctgcagcgc      1920
     aagcgcgtgc gtgtcggctc actggaggta cctgcgtact tcatcttcgg tgcgcatgta      1980
     tcgccgagcg ggttcatggg ggatgcctcc aacgcggaaa tggcctatcg gctgcaggca      2040
     ctgatggaaa gcgagtccgt gcgctacacc ctggcacttg ccaggcttct gcagaagcgg      2100
     gcgccatggg tactgcgctt gggtaaatgg tcggtgcaga gactggcgcc gatctatcgc      2160
     cgattgcggt ga                                                          2172
//

If you have problems or comments...

PBIL Back to PBIL home page