(data stored in ACNUC7421 zone)

EMBL: CP001111.PE496

CP001111.PE496       Location/Qualifiers
FT   CDS_pept        584297..585895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mav:MAV_0212 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50201"
FT                   /db_xref="GOA:B4SIJ6"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIJ6"
FT                   /protein_id="ACF50201.1"
FT                   /translation="MATPTAPLLRLTLLGVGLVLVLLPGVLLMRELLHVGMQEDAMIGL
FT                   RHLRNMLEGSGFVYNRGESALGATNPLFWIFSFLAIKPFYLASPSLDVLVAHYYFCGFA
FT                   LLAAAIAFAMATPSRTRTVSVAAMALLSVLFFWPLRFLYLGLEGPFMLVCVGVIGLLAV
FT                   RSVGTRDGLLATLVGFLSWNRPEIALILIPAVLFYALLMSDKSSRIRVSVGYLAGAVAF
FT                   PLMLKLVSGAYIVGTVQAKAYFGNPSPPYNLDFFVQRIIYLDSFIGLGGGVTVLLLVGI
FT                   FASAIIGILDFLQGDRKQMPWVRGVYPAFVAGYSCFVLFIPSLWEWYVTFWLSFALVQY
FT                   GVLISRGINCCFSALRGNVGAAVLGVTIVLLSTSWLMGHRLATQRTEIVGWITQDAGFR
FT                   GRLSKELNERWHARSVWMEAAGWQGYFNNARIFDEVGLVDDETQPLAQKYGCAYFVSAL
FT                   KELQPQFVIKRQFEMDRNVMLTPPRSCPNAPLFSNDADRLWFDSNYEAVEHYGTPAPGY
FT                   FGEYSFLVLYRSRNK"
     atggcgacgc ccacagcgcc attgctcaga ttgaccctgc tgggagtcgg cctggttctg        60
     gtgctcctgc ctggcgtgct tctgatgcgg gagttgctgc acgttggcat gcaggaagac       120
     gcgatgatcg gactgcgtca tctgcgcaac atgctcgagg gcagcggatt cgtatacaac       180
     cgcggtgaat cggcactcgg cgcgacaaat ccgcttttct ggatcttctc gttccttgcc       240
     atcaagccat tctacttggc aagtccgtcc ctcgacgtgt tggtggcgca ctactatttc       300
     tgcgggtttg cgctgctggc agcggctatc gcctttgcaa tggccacgcc ttcgcggact       360
     cgcactgtgt cggttgctgc catggcgctc ctgagcgtcc tgttcttctg gcccctgcgc       420
     ttcctctatc tggggcttga agggccgttc atgctcgtat gtgttggcgt tattggcctg       480
     ctggctgtcc gatctgtggg cacgcgggat ggtctgctcg caacactggt tggcttcctg       540
     tcatggaacc ggccggaaat tgcactcatt ctgattcctg cagtcctctt ctatgcactg       600
     ctgatgtcgg acaagtcgag ccgtatccgg gtctcagtcg gctatctggc aggcgcagtg       660
     gcattcccgt tgatgctgaa gctcgtatcc ggcgcttaca tcgtgggcac agtgcaggcg       720
     aaggcatact ttggcaatcc cagtccaccg tacaatcttg atttcttcgt gcagcggatc       780
     atctatctgg actcattcat cggtcttggt ggtggggtga cggtgcttct gctggtgggc       840
     attttcgctt ctgcaatcat cggcatcctc gatttcctgc aaggtgatcg caagcagatg       900
     ccgtgggttc gaggcgtgta ccccgcgttc gtcgcaggat attcgtgttt cgtcctgttc       960
     attccttctc tgtgggaatg gtatgtaact ttctggcttt ccttcgcgct ggtccagtat      1020
     ggcgttctca tcagtcgagg aatcaattgc tgcttctcag cactgcgtgg caatgtaggc      1080
     gcagccgtgc tgggcgtcac aatcgtgctg ttgtctacga gctggttgat ggggcaccga      1140
     cttgcaaccc agcgcacgga gatcgtcggt tggattaccc aggacgcggg tttccgtggc      1200
     cgcttgtcca aggaactgaa cgagcgctgg catgctcgct cggtctggat ggaggctgct      1260
     ggctggcagg gttatttcaa caatgcgcgc atcttcgacg aagtcgggct ggtggatgat      1320
     gaaacacagc cgctggcaca gaagtacggc tgcgcgtatt tcgtttctgc actcaaggag      1380
     ttgcagccac aattcgtcat caagaggcag ttcgagatgg accggaacgt gatgctgacg      1440
     cctccgcgca gttgcccgaa cgcgcctctc ttctcgaatg atgcggatcg actctggttt      1500
     gattccaact atgaggccgt ggagcactac ggaacgcccg ctcccggcta cttcggagag      1560
     tattcattcc tcgtcctcta ccgtagccgc aacaagtag                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page