(data stored in ACNUC7421 zone)

EMBL: CP001111.PE497

CP001111.PE497       Location/Qualifiers
FT   CDS_pept        complement(586256..586684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: maq:Maqu_1646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50202"
FT                   /db_xref="GOA:B4SIJ7"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIJ7"
FT                   /protein_id="ACF50202.1"
FT                   /translation="MSRSRLIFAYSSFAAASILVNIGTQALAVLLYQGPYSVPASVVLG
FT                   TATGLLCKYFLDKHFIFGHSSESASQEAKTFTLYVVMGLATTLIFWGTEAAFHFIFEED
FT                   AMRYVGGIIGLSIGYAVKYRLDSHFVFKKTAVPGRRHD"
     ttgagcagat cacgtttgat ctttgcctac tcgagctttg cggccgcctc cattctggtc        60
     aacatcggca cccaggcctt ggctgtcctt ctgtatcagg gaccatattc ggtgccggcg       120
     tctgtcgtgc ttggaactgc aacaggcctg ttgtgcaagt acttcctcga caagcacttc       180
     atcttcggcc atagctcaga gagcgcctcc caagaagcaa agacattcac cctttatgta       240
     gttatggggc tggcgacgac gctgattttc tgggggaccg aagctgcctt ccacttcatt       300
     ttcgaagaag acgccatgag gtatgtcgga ggaatcattg gcctgagcat cggctacgcg       360
     gtgaagtaca ggcttgattc gcactttgtc ttcaagaaga cggcggtgcc aggccgccgt       420
     cacgactga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page