(data stored in ACNUC7421 zone)

EMBL: CP001111.PE498

CP001111.PE498       Location/Qualifiers
FT   CDS_pept        complement(586681..587412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0498"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: xac:XAC3591 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50203"
FT                   /db_xref="GOA:B4SJ35"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ35"
FT                   /protein_id="ACF50203.1"
FT                   /translation="MQKILIIGATSAIAEAVARQYAGRAAALYLVGRSAGKLDAIAADL
FT                   RVRGAQRVETGVLDVNHVAAHGGLLDNAWAAFGGIDTVLIAHGTLPDQAACDASVDLSL
FT                   HEFATNATATIALAAALAQRLQHGATLAVISSVAGDRGRASNYLYGSAKAAVTTYLSGL
FT                   GQRLHASGVNVLAIKPGFVDTPMTAAFKKGALWATPEQVANGILKAIGKRKSVAYLPGF
FT                   WWAVMMIIKNIPEFIFRRIKL"
     atgcagaaga tcctgatcat cggcgcgaca tcggccatcg ccgaggcggt agcacgccaa        60
     tacgccggac gtgccgcggc gctctatctg gtcggccgta gcgccgggaa gcttgatgcc       120
     attgccgccg acctacgcgt gcgcggcgcg cagcgtgtgg agaccggggt tctggacgtg       180
     aaccatgtgg ccgcacacgg tggactgctg gacaacgcat gggcagcgtt tgggggcatc       240
     gataccgttc taatcgccca cggcactctg ccggaccagg ccgcctgcga tgcctctgta       300
     gacctgtcac tacacgagtt cgccacaaat gccaccgcga cgatcgctct tgccgctgca       360
     cttgcacagc gtctacagca tggcgctact ctggccgtga tctcctcggt agcgggcgat       420
     cgcggtcgcg ccagcaacta cctgtacggc agtgcaaaag ccgccgttac cacctatcta       480
     agcgggcttg gccagcgcct gcacgcgagc ggcgtcaatg tattggccat caagcctgga       540
     ttcgtcgata caccaatgac agccgcgttc aagaagggag cactctgggc gacaccggaa       600
     caggtggcca acgggattct caaggcaatt ggaaagcgca aatccgtggc ttacctgcct       660
     ggcttctggt gggcggtaat gatgatcatc aagaatatcc cagaattcat tttccgcagg       720
     atcaagcttt ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page