(data stored in ACNUC7421 zone)

EMBL: CP001111.PE5

CP001111.PE5         Location/Qualifiers
FT   CDS_pept        7655..8500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0005"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: xcb:XC_0005
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49710"
FT                   /db_xref="GOA:B4SR09"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR09"
FT                   /protein_id="ACF49710.1"
FT                   /translation="MSASAPVSAPPPVPPASTAPRAGSPLAGFFIDLGIAAVTLFGLSM
FT                   VTGLLWGFYRAIVVGYANAQANGGALSPAETTAAVGQPGALAQILMALIATGGAALLLY
FT                   FWRRPANAAERLASRQALRQPSTWGWTVLVALLIVLGSNGIAFLAKQFGIAPVPTNVEL
FT                   MQNAIARFPLFLVLFAVVLAPAYEELLFRRVLFGRLWQAGRPWLGVILSSLAFALVHEV
FT                   PGVSRNSLLGMAQLWLVYGGMGAAFCWLYQRTGTLWAAITAHALNNAVALAAMVFLGST
FT                   "
     atgtccgctt ccgccccggt ttccgccccg cctccggttc cgccggcgtc caccgcgccg        60
     cgtgcgggtt ccccgttggc aggcttcttc atcgacctgg gcattgctgc cgtcaccctg       120
     ttcggcctga gcatggtcac cggcctgctc tggggcttct atcgcgccat cgtggttggc       180
     tacgccaatg cacaggccaa cggcggcgcc ctgtcgccgg cagaaacaac ggcggccgtc       240
     ggccagccgg gggccctggc gcagatcctg atggccctga tcgccaccgg tggagccgcc       300
     ctgctgctgt acttctggcg gcgcccggcc aatgcggccg aacgcctggc ttcacgacag       360
     gcgctgcggc agccctcgac ctggggctgg accgtgctgg tggccttgct gatcgtgctg       420
     ggcagcaacg gcatcgcctt cctggccaaa cagttcggca tcgcgccggt gcccaccaac       480
     gtggaactga tgcagaacgc gatcgcgcgt ttcccgctgt tcctggtgct gttcgcggtc       540
     gtgctggcgc ctgcctatga ggagctgctg ttccgccgcg tgctgttcgg ccgcctgtgg       600
     caggctggcc gtccctggtt gggagtgatc ctcagcagcc tggccttcgc gctggtccac       660
     gaagtgcctg gggtgagcag gaattcactg ttgggcatgg cccagctgtg gctggtctac       720
     ggtggcatgg gcgccgcgtt ctgctggttg taccagcgca ccggcacgct gtgggcggcg       780
     attacagccc atgcactgaa caacgctgtc gcacttgccg cgatggtgtt cctgggatca       840
     acgtaa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page