(data stored in ACNUC7421 zone)

EMBL: CP001111.PE500

CP001111.PE500       Location/Qualifiers
FT   CDS_pept        complement(588725..590143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0500"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: xac:XAC3589
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50205"
FT                   /db_xref="GOA:B4SJ37"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ37"
FT                   /protein_id="ACF50205.1"
FT                   /translation="MTASNRPLCVDLDGTLLRSDILYESLLALLAHNPLYVFLVPFWLL
FT                   KGKAYVKRQLASRVQLPAAILPYDERVLEILRTTTQRPRVLCTASDRLLVQPIADHLDL
FT                   FEEVMASDGYTNLSGTNKGQALAERFGERGFDYMGNGQVDLKVWAHAGGAIVVNNGNGL
FT                   VRAASTRTEVLAHLPSQSGGLLTWIKALRVYQWLKNLLVLVPLLTAHRFFDIGSVVDAG
FT                   VAFLAFGLCASGVYLLNDLLDLTPDRMHPRKRRRPFAAGTLPLLHGLLAAPLITLAGFA
FT                   LALACSPAFAGVLLCYYVMTLSYSLKLKRIVMIDVVMLAALYTVRIIGGAVAISSELSF
FT                   WLLAFSMFVFLSLAMLKRYTELASALASGKEVAIGRGYSVADLPLVQSLGAAAGYIGVL
FT                   VFALYINSPESLELYTSPKLLWLLCPILLYWISRMWIVSHRGDMHDDPIVFAATDRSSQ
FT                   IVIGLCLLIVLIAI"
     gtgacggctt ccaatcgacc gctttgcgtg gatcttgatg gaaccctact gcgttccgac        60
     atcctctacg agtccttgtt ggcgctgttg gcgcacaatc cactgtatgt cttcctggtt       120
     cccttctggc tgttgaaagg caaggcgtat gtgaagcgcc aactggcctc gcgcgtgcaa       180
     ttgcccgcag caattttgcc ttatgacgag cgggtcctgg aaattctacg caccaccacg       240
     caacggccgc gcgtactgtg tacggcgtcg gaccggctgt tggtccaacc cattgccgac       300
     catctggacc tgttcgaaga ggtcatggcc agcgatgggt acaccaacct gtccggcacc       360
     aacaaagggc aggcattggc ggagcgcttc ggtgaacgcg gcttcgacta tatgggtaac       420
     ggccaggtcg acctgaaggt ctgggcgcac gccggaggag ccattgttgt caacaatggc       480
     aacgggctgg tccgcgcggc aagcacgcgg acggaagtcc tggcccacct gccgtctcag       540
     agcggaggcc tgctcacctg gatcaaggcc cttcgcgtct atcagtggct gaagaacctg       600
     ctggtgctgg tgcccttgct gactgcccac cgcttcttcg acatcggctc ggtcgtcgat       660
     gccggggtgg ccttcctggc attcggcctg tgcgcgtcag gcgtctacct gctcaacgac       720
     ctgctggact tgactcccga tcgtatgcat ccgcgcaagc gccggaggcc atttgccgcc       780
     gggacgctgc cattgctgca cgggctgctg gcagccccgc tgatcacgct ggccggattc       840
     gcactcgccc tggcctgcag cccagccttc gccggcgtgt tgctgtgcta ttacgtaatg       900
     acattgagct actccctcaa gctcaagcgc attgtgatga ttgacgtcgt aatgctggcg       960
     gcgctgtaca ccgtgcgtat cattggcggc gcagtggcaa tcagctctga actctcgttc      1020
     tggctgttgg ctttctcgat gttcgtgttc ctcagcctgg ccatgctcaa gcgctatacg      1080
     gaactggctt cggcgctggc cagtggcaag gaagtggcca tcggccgtgg ctactctgtg      1140
     gccgacctgc cgttggtgca atcattggga gccgccgcag gttacattgg cgtgctggta      1200
     ttcgcgctgt acatcaacag ccccgaaagc ctggagctat acaccagccc gaaactgcta      1260
     tggctccttt gtccgatcct gttgtactgg atcagccgca tgtggatcgt ctctcaccgt      1320
     ggcgacatgc atgacgatcc catcgtattc gctgcgacag accgtagtag tcaaatcgtg      1380
     atcggcttgt gcctcctcat cgtcctgatc gcaatatga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page