(data stored in ACNUC7421 zone)

EMBL: CP001111.PE501

CP001111.PE501       Location/Qualifiers
FT   CDS_pept        complement(590536..591474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0501"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit ; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: xcb:XC_3615 electron transfer flavoprotein
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50206"
FT                   /db_xref="GOA:B4SJ38"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ38"
FT                   /protein_id="ACF50206.1"
FT                   /translation="MSRILVIAEHHDGKLNAATAKTVSAATAIAGASIDVLVLAADPAA
FT                   VAAEAAKIAGVAKVLTVANAANAQAIAQVLAPQIAQLAKGYTHLFGPSTTFGKDLMPCV
FT                   AALLGVNQVSDLMSVEGSHTFKRPIYAGNAIITVEAPADQIVVATVRAASWPEAAQGGS
FT                   AAIEAANVDAALPTHTRFVGLAAGASDRPDLQSAKRVVSGGRGVGSEENFKVIFQLADK
FT                   LGAAVGASRAAVDAGYVPSDLQVGQTGKIIAPELYVAVGISGAIQHLTGIKDAGTIVAI
FT                   NKDGDAPIFEIADIGLAGDLFAILPELEKAL"
     atgagcagga ttctcgtcat cgccgaacac cacgacggca agctcaacgc cgccaccgcc        60
     aaaaccgtca gcgccgccac cgccatcgca ggtgccagca tcgacgtgct ggtgctggcc       120
     gccgacccgg ccgccgttgc cgccgaggcc gcgaagatcg ctggcgtcgc caaggtcctg       180
     accgtggcca acgctgccaa tgcgcaggcc atcgcccagg tgctggcgcc gcagatcgcg       240
     cagctggcca agggttacac ccacttgttc ggcccgtcga ccaccttcgg caaggacctg       300
     atgccgtgcg tggccgcctt gcttggcgtc aaccaggtct ccgacctgat gagcgttgaa       360
     ggcagccaca ccttcaagcg tccgatctac gccggcaacg cgatcatcac cgtggaagcc       420
     ccggccgacc agatcgtggt cgccaccgtg cgtgccgcct cgtggccgga agccgcccaa       480
     ggcggcagcg ccgccatcga agcggccaac gtcgatgctg ccctgccgac ccacacccgc       540
     ttcgtcggcc tggccgccgg tgccagcgac cgtccggacc tgcagagcgc caagcgtgtg       600
     gtctccggtg gtcgtggtgt cggttcggaa gagaacttca aggtcatctt ccagctggcc       660
     gacaagctcg gtgccgccgt cggtgcttcg cgtgccgcag ttgatgccgg ctatgtgccc       720
     agcgacctgc aggttggcca gaccggcaag atcatcgcgc cggaactgta tgtggcggtc       780
     ggcatcagtg gtgcgatcca gcacctgacc ggcatcaagg atgccggcac gatcgtggcg       840
     atcaacaagg acggcgacgc gccgatcttc gagatcgccg acatcggcct ggcgggggat       900
     ctgtttgcga tcctgccgga gctggaaaag gcgctgtaa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page