(data stored in ACNUC7421 zone)

EMBL: CP001111.PE503

CP001111.PE503       Location/Qualifiers
FT   CDS_pept        592506..593561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0503"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: xcv:XCV3709 dTDP-glucose
FT                   4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50208"
FT                   /db_xref="GOA:B4SJ40"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ40"
FT                   /protein_id="ACF50208.1"
FT                   /translation="MPTWLVTGGAGFIGGNFVLEAVARGVKVINLDVLTYAGNLKTLSS
FT                   LDGNPNHLFVQGDIGDRELVTRLLAEHRPDAVLNFAAESHVDRSIDVPGAFIQTNVVGT
FT                   LGLLEAVRDYWKALPAEQGADFRFLHVSTDEVYGTLGETGKFSETTPYAPNSPYSASKA
FT                   ASDHLVRAFHHTYGLPVLTTNCSNNYGPYHFPEKLIPLVIAKALAGEPLPVYGDGKQVR
FT                   DWLFVSDHCEAIRTVLAKGQVGETYNVGGNSEKQNIEVVQAICALLDARRPREDGQPRS
FT                   SQITYVADRPGHDRRYAIDASKLKNDLGWEPAYTFEQGITFTVDWYLDNQEWVNGVLDG
FT                   SYRLQRIGTAG"
     gtgcccacat ggcttgtcac cggcggcgcc ggattcattg gcggtaactt cgttcttgaa        60
     gccgtcgcgc gcggcgtcaa ggtcatcaac cttgatgtgc tgacctacgc cggcaacctg       120
     aagaccctgt ccagccttga tggcaacccg aaccacctgt tcgtccaagg cgacatcggt       180
     gaccgcgaac tggtcacccg cctgctggcc gagcaccggc cggacgcggt gctcaacttc       240
     gccgccgaga gccacgtgga tcgctccatc gacgttccgg gcgccttcat ccagaccaac       300
     gtggtgggta ccctgggcct gctggaagcg gtccgtgact actggaaggc gctgccggcc       360
     gagcagggtg cggacttccg cttcctgcac gtgtccaccg acgaggtgta cggcaccctg       420
     ggcgagaccg gcaagttcag cgaaaccacg ccgtatgccc cgaattcgcc gtactcggcg       480
     tcgaaggcgg cttcggacca cttggtccgc gccttccacc acacctacgg gctgccggtg       540
     ctgaccacca actgctccaa caattacggc ccgtaccact tccccgagaa gctaattccg       600
     ctggtgatcg ccaaggcgct ggctggcgag ccgctgcctg tctacggcga tggcaagcag       660
     gtgcgcgact ggctgttcgt gtccgaccac tgcgaagcga tccgcaccgt gctggccaag       720
     ggccaggtcg gcgagaccta caacgtcggc ggcaactcgg aaaagcagaa catcgaagtg       780
     gtgcaggcga tctgtgcgct gctcgatgcg cgccgcccgc gtgaggatgg ccagccgcgc       840
     agcagccaga tcacctacgt ggccgatcgc cccggccacg accgccgcta cgcgatcgat       900
     gcgtcgaagc tgaagaacga cctgggctgg gaaccggcct acaccttcga gcagggcatc       960
     accttcaccg tcgactggta cctcgacaac caggaatggg tcaacggcgt gctcgacggc      1020
     agctaccgtc tgcagcgcat cggcaccgcg ggctga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page