(data stored in ACNUC7421 zone)

EMBL: CP001111.PE512

CP001111.PE512       Location/Qualifiers
FT   CDS_pept        602884..603288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0512"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: xfn:XfasM23_1626
FT                   GtrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50217"
FT                   /db_xref="GOA:B4SJ49"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ49"
FT                   /protein_id="ACF50217.1"
FT                   /translation="MPPVVARKDALAGQFIRYVINGLAATAVHYGVLRFNIEVLHIPLA
FT                   AAANALAAVFGIIASFLGSRYFVFRGRQGNVARQGSLFLLVYAGIALLHGLVMYVWADR
FT                   LQLDYRIGFVLATGMQMTISFAANKFLVFK"
     atgccacccg tcgtagcgcg taaggacgcg ctggctggcc agttcattcg atatgtgatc        60
     aacggcctcg ccgccacggc cgttcactac ggggtgctgc gcttcaacat cgaggtgctg       120
     cacatcccgc tcgccgcggc ggccaatgct ctggcagcgg tgtttggcat catcgcctcg       180
     ttccttggca gccgctattt tgtctttcgc ggcagacagg gaaacgtggc gcggcaaggc       240
     tcgttgttcc tgctggtcta tgccggcatc gccctgttgc atgggctggt gatgtacgtc       300
     tgggcagacc ggttgcagtt ggattaccgt atcggtttcg tgctggccac gggcatgcag       360
     atgaccatca gttttgctgc caataaattc ctggtgttca aatga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page