(data stored in ACNUC7421 zone)

EMBL: CP001111.PE513

CP001111.PE513       Location/Qualifiers
FT   CDS_pept        603285..603884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfm:Xfasm12_1695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50218"
FT                   /db_xref="GOA:B4SJ50"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ50"
FT                   /protein_id="ACF50218.1"
FT                   /translation="MNRYLRAVLATVIFVVALLLVYYVHMRHFRVNVVLYASILDAVIA
FT                   LVVVFAGLYLLKWFRDFSRLELIQLAAIWLLGGYVFAISVPTVIDRSLSFYILEKLQQR
FT                   GGGIREDAFHEVFTEEYVREHHLVEVRLTEQLQSGTVQIDGGCVRLTARGERLASFSRF
FT                   YRKNLLPTHRLLMGQYTDALTDPFRDSRMPTDYRCQ"
     atgaacagat acctgcgcgc cgtattggcg accgtcatct tcgtggttgc cctgctgctg        60
     gtctactacg tgcatatgcg ccacttccgg gtgaacgtgg tgctgtacgc cagtatcctt       120
     gatgcggtga tcgcccttgt ggtcgtgttc gcagggctgt atctgctgaa atggttccgc       180
     gatttcagtc gtctggagct gatccagctc gcggccatct ggctgctggg cggctacgtg       240
     ttcgcgatct ccgtacccac agtgattgat cggtcgctgt cgttctacat tctggaaaag       300
     ctgcagcagc gtggtggtgg catccgcgag gatgcattcc acgaggtctt caccgaagag       360
     tatgtgcgtg agcatcatct ggtggaggtg cgtttgaccg agcagctgca gtccggcacg       420
     gtgcagatcg atggcggctg tgtcaggttg acagcccggg gtgagcgctt ggcctcattc       480
     agccgcttct accggaaaaa cctgctgccg acccatcgcc tgttgatggg ccagtacacc       540
     gatgcgctga ccgatccttt ccgcgacagc cggatgccga ctgactaccg ttgccagtag       600
//

If you have problems or comments...

PBIL Back to PBIL home page