(data stored in ACNUC7421 zone)

EMBL: CP001111.PE516

CP001111.PE516       Location/Qualifiers
FT   CDS_pept        complement(605567..608881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0516"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: bxe:Bxe_B1664 putative helicase; PFAM:
FT                   SNF2-related protein; helicase domain protein; zinc finger
FT                   SWIM domain protein; SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50221"
FT                   /db_xref="GOA:B4SJ53"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ53"
FT                   /protein_id="ACF50221.1"
FT                   /translation="MTPTFTDEDLFRWIDEWTLQKSEQCLGGVRNRQLRDGLLTAEVQG
FT                   SARHPYYVEIDLTASTRTARSRLQSACSCPVGRTCKHVAAVLVSYMLDSLAMDDESPLT
FT                   EQNLTQPPRPELLAELSRWQSARIQPAQPRRNGVIFELSTYNHHPAVLVRRVKYGTDGA
FT                   ISTGKWMDITADLLLDPPAYLTPTDLAVMIQLRTQRQPATKDEWIDFAATLQLIVSSGH
FT                   GWVSCGTHGDVPARSGAPRRGELGWTVGMTQGATLLEPALSVEGGARGVVLGRSACYLD
FT                   PVTGEVGPLLLDVRAEDADAFLSLPNLLPNEEAVVAQMLQQIDPALPRPGASDTLPTLQ
FT                   ISAMIPVLRLHTIEFRPAWLGRRDPSQWADIATVAFEYDEHVRFLDDPSLFAHDTEGRL
FT                   ALLPRDLAEEARREGELRSVKLHRDPQPRAVLDGAGPQFQLRTHDWTGFLLGDVPRLEA
FT                   LGWKVETDDDFRHRITRVDEIDLDIQADPEDAGWFNLGLEIQVDGRKVSMVPLLQQVLH
FT                   ADPRWSRGQLDAIGDDENILLTASGNTRLALQASRLKPIMALLADLFTQRGAPLRLSAH
FT                   DRGRLQALQDDAHLQFRGHKDTQALVQRLLQAPAPEDVAPPAGLQATLRSYQREGLSWL
FT                   QYLRQQGLGGVLADDMGLGKTLQTLAHLLVEKESGRLDRPALLVVPTSLLHNWQSEAAR
FT                   FTPGLRVLTLHGPAREALFEAIPEHDLVLTTYPLLWRDEQALQSHSYHLLILDEAQQVK
FT                   NPKSRAAVTLRTLQARHRLCLTGTPLENHLGELWTQFDFLLPGLLGSEKLFNQHWRHPI
FT                   ERGSDQRRAQLLAQRLRPFILRRRKDQVAAELPPKTLITRAVTMEGGQRDLYETVRAAM
FT                   EKQVREAISDSGLARSHIRVLDALLKLRQVCCDPRLLPGETPARNAGSAKLELLREMLP
FT                   SMVEEGRRILLFSQFTGMLALIAQALDGLGLAYVTLTGDTQDRVTPVQRFMQGEVPLFL
FT                   ISLKAGGVGLNLTAADTVIHFDPWWNPAAENQASDRAHRIGQQQPVFVYRLIAAGSIEE
FT                   RIAELQERKAMLAESILEGGGSAGPRFSEEDVQALLAPLPGALPARRKAGRQSKVR"
     atgacgccga ccttcacaga cgaagacctg ttccgctgga tagacgaatg gacactgcag        60
     aaaagcgagc agtgcctggg tggcgtgcgc aaccggcaac tccgcgatgg cctgctgacg       120
     gccgaggtac agggttcggc caggcatccc tactacgtgg agatcgatct gacggccagt       180
     acgcgcaccg cgcgcagccg cctgcagagt gcctgttcct gccccgtcgg ccgcacctgc       240
     aagcatgtgg cggcggtgct ggtctcgtac atgctggatt cgcttgccat ggacgacgaa       300
     agccccctga ccgaacagaa cctgacgcaa ccgccgcgtc ctgaactgct ggcggagctt       360
     tcgcgttggc agagcgcgcg gatccagccg gcccagccac gccggaacgg tgtcatcttc       420
     gaactgtcca cctataacca ccaccccgcc gtgctggtcc ggcgcgtcaa gtacgggacc       480
     gatggtgcga tcagcacggg caagtggatg gatatcaccg cggacctgct gctggatcct       540
     ccggcatatc tcacgccgac tgatctggcg gtgatgatcc agctacgcac ccagcggcag       600
     cccgcgacga aggacgaatg gatcgacttc gcggccaccc tgcagttgat cgtctccagc       660
     ggccatggct gggtctcctg cggtacgcac ggcgacgtgc cggcccggtc aggagctcca       720
     cgccgcggcg aactgggctg gaccgttggc atgacgcagg gcgcgacgct gctggaaccc       780
     gcgttgagcg tggagggcgg cgccagaggc gtggtcctgg gccggagtgc gtgctatctg       840
     gacccggtca ccggcgaggt cggtccgctg ctgctggatg tcagggccga ggacgccgac       900
     gccttcctga gcctgcccaa tctgttaccc aacgaagaag cggtggtcgc acagatgctg       960
     caacagatcg accctgccct gccgcgcccc ggtgcaagcg acacgctgcc caccctgcag      1020
     atcagcgcga tgatccccgt gctgcgcctg catacgattg agttccggcc ggcatggctc      1080
     ggccgccgcg acccgtcgca atgggccgat atcgcgaccg tggccttcga gtacgacgag      1140
     catgtgcggt tcctggatga cccgagcctg ttcgcccacg acaccgaggg ccggctggcc      1200
     ctgttgcccc gcgacctggc tgaagaagcg cgacgggaag gcgagctgcg cagtgtgaag      1260
     ctgcaccgcg acccgcagcc acgcgcggtt ctggatggcg caggccctca attccagctg      1320
     cgtacccatg actggaccgg attccttctg ggcgatgtac cacgactgga ggccctcggc      1380
     tggaaggtgg agacggatga cgatttccgc catcgcatca cccgggtgga tgagatcgat      1440
     ctggacatcc aggcagaccc ggaggacgcg ggctggttca acctggggtt ggagatccag      1500
     gtggatggcc gcaaagtgtc catggttccg ctgctgcagc aggtgctgca cgccgatccg      1560
     cgctggtcgc gcggccagct ggacgccatt ggcgatgacg agaacatcct gctgactgcc      1620
     agcggcaaca cgcgcctggc gctgcaggcg tcgcgactga agccgatcat ggccctgctg      1680
     gccgacctgt ttacccagcg tggtgcaccg ttgcgcttgt cggcgcacga ccgcggccgc      1740
     ctgcaggcgc tgcaggacga tgcacacctg cagttccggg gtcacaagga cacccaggca      1800
     ctcgtgcagc gcctgctgca ggcgccagca ccggaagacg tggcaccgcc tgcgggattg      1860
     caggcgacgc tgcgcagcta ccaacgcgaa ggcctgtcgt ggctgcagta tctgcgccag      1920
     caggggctgg gcggcgtgct ggccgatgac atgggcctgg gcaagaccct gcagaccctg      1980
     gcccatctgc tggtcgagaa ggaaagtggc cgcctggacc ggcctgcgct gctggtggtg      2040
     ccgacctcgc tgctgcacaa ctggcagagc gaagcggcac gcttcacccc gggcctgcgc      2100
     gtactgaccc tgcacggacc ggcacgtgaa gcgctgttcg aggctatccc cgagcacgat      2160
     cttgtactga ccacgtatcc cctgctgtgg cgcgacgagc aggcgttgca gtcccattcc      2220
     taccatctgc tgatcctgga cgaggcgcag caggtgaaga acccgaaatc gcgggcggcg      2280
     gtcacgctgc gcacgctgca ggcgcgtcat cgcctgtgcc tgaccggtac gccgctggag      2340
     aaccacctgg gcgaactgtg gacgcagttc gacttcctgc tgcccgggct gctcggcagt      2400
     gaaaagctgt tcaaccagca ttggcgccac cccatcgaac gcggcagcga ccagcgccgt      2460
     gcccaactgc tggcgcagcg gctgcgcccc ttcatcctgc gccggcgcaa ggaccaggtg      2520
     gccgccgaac tgccgccgaa aaccctcatc acccgtgcgg tgacaatgga gggcgggcag      2580
     cgtgatctct atgaaaccgt acgtgcggcg atggagaagc aggtccgcga ggccatcagc      2640
     gacagcggac tggcacgcag ccacatccgg gtactggatg cgctgctgaa gctgcgccag      2700
     gtctgctgcg atccgcgcct gctgccgggc gaaacgccgg cacgcaatgc cggttcggcc      2760
     aagctagagc tgctgcgcga gatgctgccg tcgatggtcg aggaaggccg ccgcatcctg      2820
     ctgttctcgc agttcaccgg catgctggcg ctgatcgcgc aggcgctcga cgggctgggc      2880
     ctggcctatg tgaccctgac cggtgatacc caggaccggg tcacgccggt gcagcgtttc      2940
     atgcagggcg aggtgccgct gttcctgatc agcctgaagg ccggcggcgt agggctgaac      3000
     ctgaccgccg ccgacaccgt catccacttc gatccctggt ggaatccggc cgccgagaac      3060
     caggccagtg accgtgccca tcgcatcggc cagcagcagc ccgtgttcgt ctaccggctg      3120
     attgccgccg gcagcatcga agagcggatc gccgagctgc aggagcgcaa ggcgatgctg      3180
     gccgaatcga ttcttgaagg cggcggcagc gccggaccgc gcttcagcga agaggacgtg      3240
     caggcgctgc tggcgccgtt gccgggtgct ttgccggcgc gacgcaaggc cggccggcaa      3300
     agcaaggtcc gctag                                                       3315
//

If you have problems or comments...

PBIL Back to PBIL home page